close all open/close all

CDS information : Stigm_00030


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction8,577 / 7,849 / - [in whole cluster]
8,577 / 7,849 / - [in contig]
Locationcomplement(7849..8577) [in whole cluster]
complement(7849..8577) [in contig]
TypeCDS
Length729 bp (242 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative methyltransferase
Product (GenBank)methyl transferase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in stigmatellin biosynthesis.
Note (GenBank)
  • ORF6
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)
Family/Domain
FD
IPR013216

close this sectionSequence

selected fasta
>putative methyltransferase [methyl transferase]
MSQNIYDDPSFFESYSQLARSLKGLAGAPEWPALRALLPDVKDLRVVDLGCGFGWFCRWA
RKNDAAHVLGLDLSEKMLTRAKAETSGDAITYQQADLERLVLPEGAFDLAFSSLAIHYVE
ELEPLLATVHRGLTPGGWFVFSIEHPIFMASRQPEWMTGPEGHRTWPVDSYQLEGKRTTH
WLAEEVVKYHRTLGTTLNALLEQGFTLRHIEEWGPTDAQLSAHPELAEERDRPMFLLVSA
QR
selected fasta
>putative methyltransferase [methyl transferase]
ATGAGCCAGAACATCTACGATGATCCGAGCTTCTTCGAGAGTTACAGCCAGCTCGCACGC
TCCTTGAAAGGCCTCGCTGGCGCCCCTGAGTGGCCGGCACTCCGTGCGCTCCTCCCCGAC
GTCAAGGACCTTCGGGTCGTCGATCTCGGGTGCGGTTTCGGCTGGTTTTGCCGCTGGGCG
AGGAAGAACGACGCCGCCCACGTGCTCGGACTGGACCTGTCCGAGAAGATGCTCACTCGC
GCGAAGGCCGAAACCTCGGGTGACGCAATCACCTACCAACAAGCCGACCTGGAGCGCCTG
GTGCTTCCAGAAGGGGCCTTCGACCTCGCCTTTAGCTCGCTCGCCATCCACTACGTGGAG
GAACTGGAACCGCTCCTCGCGACTGTTCACCGGGGGCTGACGCCAGGCGGATGGTTTGTC
TTCTCCATCGAGCATCCCATCTTCATGGCGTCGCGCCAACCCGAGTGGATGACCGGCCCG
GAGGGTCACAGAACGTGGCCGGTCGACAGCTATCAGTTGGAGGGAAAGCGCACGACGCAT
TGGCTGGCGGAAGAGGTGGTCAAATACCACCGGACGCTCGGGACCACACTGAACGCTCTG
CTGGAACAGGGCTTCACCCTGCGGCATATCGAGGAGTGGGGGCCAACCGATGCTCAACTC
TCGGCGCATCCGGAACTGGCCGAGGAGCGGGACCGACCCATGTTCTTGCTGGTCTCCGCG
CAGCGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [47-141]  7.4e-23 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit