close all open/close all

CDS information : Stigm_00040


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction8,879 / 8,622 / - [in whole cluster]
8,879 / 8,622 / - [in contig]
Locationcomplement(8622..8879) [in whole cluster]
complement(8622..8879) [in contig]
TypeCDS
Length258 bp (85 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA-binding protein
Product (GenBank)acyl-CoA binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF5
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)
Related Reference
ACC
C8CB64
PmId
[19766195] An acyl-CoA-binding protein (FcACBP) and a fatty acid binding protein (FcFABP) respond to microbial infection in Chinese white shrimp, Fenneropenaeus chinensis. (Fish Shellfish Immunol. , 2009)
ACC
P11030
PmId
[2803267] Acyl-CoA-binding protein in the rat. Purification, binding characteristics, tissue concentrations and amino acid sequence. (Biochem J. , 1989)

close this sectionSequence

selected fasta
>putative acyl-CoA-binding protein [acyl-CoA binding protein]
MALEDDFRSAQERVKALKTRPSNDRLLELYSLFKQATEGDVQGKRPGILDVKERAKYDAW
VGRKGLGRESAMQQYVALVERLLRG
selected fasta
>putative acyl-CoA-binding protein [acyl-CoA binding protein]
ATGGCACTCGAGGATGACTTCCGTTCCGCGCAGGAACGCGTGAAGGCGCTCAAGACGCGC
CCCTCCAACGACAGGCTGTTGGAGCTGTATTCGCTCTTCAAGCAGGCCACCGAGGGCGAC
GTGCAGGGCAAGCGCCCGGGGATTTTAGACGTCAAGGAGCGCGCCAAGTACGACGCCTGG
GTCGGCCGCAAGGGCCTGGGCCGCGAGTCGGCCATGCAGCAATACGTGGCACTCGTGGAG
CGGCTACTGCGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000582 Acyl-CoA-binding protein, ACBP (Domain)
 [3-83]  3.09999999999998e-28 PF00887
PF00887   ACBP
 [4-19]  2.10000267834031e-23 PR00689 [21-39]  2.10000267834031e-23 PR00689 [44-59]  2.10000267834031e-23 PR00689 [65-82]  2.10000267834031e-23 PR00689
PR00689   ACOABINDINGP
 [3-85]  PS51228
PS51228   ACB_2
 [3-85]  7.89999609889417e-28 SSF47027
SSF47027   ACBP
IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle (Domain)
 [2-83]  5.69999999999998e-31 G3DSA:1.20.80.10
G3DSA:1.20.80.10   ACBP
IPR022408 Acyl-CoA-binding protein, ACBP, conserved site (Conserved_site)
 [21-39]  PS00880
PS00880   ACB_1
SignalP No significant hit
TMHMM No significant hit