close all open/close all

CDS information : Stigm_00050


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction9,066 / 10,070 / + [in whole cluster]
9,066 / 10,070 / + [in contig]
Location9066..10070 [in whole cluster]
9066..10070 [in contig]
TypeCDS
Length1,005 bp (334 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)potassium channel beta chain
Gene
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)
Related Reference
ACC
Q70J78
NITE
Chro_00200
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
ACC
Q194Q1
NITE
Mith_00240
PmId
[12733914] Mithramycin SK, a novel antitumor drug with improved therapeutic index, mithramycin SA, and demycarosyl-mithramycin SK: three new products generated in the mithramycin producer Streptomyces argillaceus through combinatorial biosynthesis. (J Am Chem Soc. , 2003)
[16571899] Novel GC-rich DNA-binding compound produced by a genetically engineered mutant of the mithramycin producer Streptomyces argillaceus exhibits improved transcriptional repressor activity: implications for cancer therapy. (Nucleic Acids Res. , 2006)

close this sectionSequence

selected fasta
>putative oxidoreductase [potassium channel beta chain]
MHFRHLGRSGLMVSEISYGNWLTHGSQVEEAAAVACVRAALDEGITTFDTADVYAGTRAE
EVLGRALQGQRREGLEIFTKVYWPTGPGPNDRGLSRKHILESIHGSLRRLKTEYVDLYQA
HRYDTETPLEETMQAFSDVVRQGKAHYIGVSEWTADQLREGVKLSRQMGFQLVSSQPQYS
MLWRVIEAEVVPASQELGVGQVVYSPIAQGVLTGKYRPGQKPPEGSRATDEKGGASFIKR
FLNDDVLTRVQQLTPVAQEAGLSLAQLAVAWVLQNPNVSSAIIGASRPEQVKENVKAAGV
KLSEEAMRHIDTLLGPIVERNPKKTLENSPRKRP
selected fasta
>putative oxidoreductase [potassium channel beta chain]
ATGCACTTCCGCCACCTTGGCCGCAGCGGGTTGATGGTCAGTGAAATTTCTTACGGCAAC
TGGTTGACCCATGGATCCCAGGTCGAAGAGGCTGCGGCGGTTGCCTGTGTGCGGGCCGCG
CTCGACGAAGGCATCACCACCTTCGATACTGCGGACGTCTACGCGGGCACTCGCGCCGAG
GAGGTGCTGGGCCGCGCCCTCCAAGGCCAGCGCCGGGAGGGGTTGGAGATCTTCACCAAG
GTGTACTGGCCCACGGGCCCGGGCCCCAATGATCGCGGCCTGTCGCGCAAGCACATCCTC
GAATCCATTCATGGCTCGCTGCGGCGTCTGAAGACGGAGTACGTGGATCTCTATCAAGCG
CACCGCTATGACACGGAGACGCCACTGGAGGAGACGATGCAGGCTTTCTCCGATGTGGTG
CGTCAGGGCAAGGCGCACTACATCGGGGTGTCCGAGTGGACGGCGGACCAACTGCGCGAG
GGTGTGAAGCTGTCACGTCAGATGGGCTTCCAGCTCGTCTCCAGCCAGCCGCAGTACTCC
ATGCTGTGGCGGGTCATCGAGGCCGAGGTGGTTCCCGCCTCCCAGGAACTGGGCGTGGGG
CAGGTCGTCTATTCCCCCATCGCGCAAGGCGTGCTCACTGGCAAGTACCGCCCGGGGCAG
AAGCCGCCCGAGGGCAGCCGCGCCACGGACGAGAAGGGGGGGGCCAGCTTCATCAAGCGC
TTCCTCAACGACGATGTGCTCACGCGCGTGCAACAGCTCACCCCCGTGGCCCAGGAAGCC
GGGCTGTCCCTGGCCCAGCTCGCCGTGGCTTGGGTGTTGCAGAACCCGAATGTCTCTTCG
GCCATTATCGGAGCCTCGCGGCCTGAGCAGGTGAAGGAAAACGTCAAGGCCGCGGGCGTG
AAGCTGAGTGAGGAGGCGATGCGCCACATCGACACCCTCCTGGGCCCCATCGTCGAGCGC
AACCCGAAGAAGACCCTGGAGAACAGTCCGCGCAAGCGGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [15-313]  1.2e-76 PF00248
PF00248   Aldo_ket_red
 [1-315]  3.4e-100 G3DSA:3.20.20.100
G3DSA:3.20.20.100   no description
 [1-319]  8.5e-97 SSF51430
SSF51430   NAD(P)-linked oxidoreductase
SignalP No significant hit
TMHMM No significant hit