close all open/close all

CDS information : Stigm_00060


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction10,428 / 10,862 / + [in whole cluster]
10,428 / 10,862 / + [in contig]
Location10428..10862 [in whole cluster]
10428..10862 [in contig]
TypeCDS
Length435 bp (144 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productribosome-binding factor A family protein
Product (GenBank)ribosome binding factor
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)
Family/Domain
FD
IPR000238

close this sectionSequence

selected fasta
>ribosome-binding factor A family protein [ribosome binding factor]
MTSFKQRRRRAPRRGTESSLSSFEAQSLPAHHLRVQSTLFQEVARLFRGELSDPLLEGVS
VTSFELTPDGRNARIGFTLPPEYAEGGSAPIEAALVRASGFIRAQLALGLNLKRVPHLRF
VCVGVAPPGFSIPEDGSAEEGGES
selected fasta
>ribosome-binding factor A family protein [ribosome binding factor]
ATGACTTCTTTCAAGCAGCGCCGTCGCCGCGCCCCCCGCCGGGGCACGGAATCTTCCCTG
TCGTCTTTCGAAGCGCAGTCCCTTCCCGCGCATCACCTGCGCGTCCAATCCACCCTGTTC
CAGGAGGTCGCCCGCCTTTTTCGGGGCGAGTTGTCGGATCCCCTGCTCGAAGGCGTCTCG
GTGACGTCCTTTGAGCTGACGCCGGATGGGCGCAACGCCCGTATTGGCTTCACCCTGCCT
CCCGAGTACGCGGAGGGTGGGTCGGCACCCATCGAAGCAGCCCTGGTCCGCGCCAGTGGC
TTCATCCGCGCCCAGCTCGCCCTGGGGCTGAACCTCAAGCGTGTGCCGCACCTGCGCTTC
GTCTGCGTGGGGGTGGCTCCTCCCGGGTTCTCCATTCCCGAGGACGGGTCGGCCGAGGAA
GGGGGTGAGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000238 Ribosome-binding factor A (Family)
 [41-121]  PD007327
PD007327   Rib_bd_factA
 [32-121]  5.40000000000001e-14 PF02033
PF02033   RBFA
IPR015946 K homology domain-like, alpha/beta (Domain)
 [32-121]  2.2e-16 G3DSA:3.30.300.20
G3DSA:3.30.300.20   KH_prok
IPR023799 Ribosome-binding factor A domain (Domain)
 [31-130]  2.49999811956465e-17 SSF89919
SSF89919   Rib_bd_factA
SignalP No significant hit
TMHMM No significant hit