close all open/close all

CDS information : Stigm_00070


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction10,859 / 12,016 / + [in whole cluster]
10,859 / 12,016 / + [in contig]
Location10859..12016 [in whole cluster]
10859..12016 [in contig]
TypeCDS
Length1,158 bp (385 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in stigmatellin biosynthesis.
Note (GenBank)
  • unnamed protein product; ORF2
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MRPRRIEGAPGAVPILAWARAVPAGAVKQLQLLARQPYLAEHVAAMPDVHVAEGVAVGTV
FATERHIVPGALGGDLGCGVSAVRFDFPAMSLGRVELTRLLAAFARAVPVGDAVHRGRGL
SLPPGLDIGRLSTHRLQREWERLVPKHLGTLGGGNHFLELDRDAEGALWLLLHTGSRGVG
AAIAAHHLRVAQVSGEGSLPGLRTDTSEGAACLADTELACQFARANRDTLLQRAVEVLAG
AIGQGPVLDSRVDVHHNHVAAESHFGRTLLVHRKGAVGLVAGQQGLIPGSMGTASYLVAG
KGEPQAFCSCSHGAGRVMTRREARERIRPAALAHALRRVVFDEGRVTALVEEAPTAYRDI
TEVLEDEAELVTPLRRLTPIAVLKG
selected fasta
>hypothetical protein [hypothetical protein]
ATGAGGCCCCGCCGCATCGAGGGAGCTCCTGGTGCCGTCCCCATCCTCGCATGGGCCCGC
GCGGTACCGGCGGGAGCGGTGAAGCAACTCCAACTGCTCGCGCGCCAGCCCTATCTGGCC
GAGCATGTGGCTGCCATGCCGGATGTGCATGTGGCCGAGGGCGTCGCGGTGGGCACGGTC
TTCGCCACCGAGCGCCACATCGTTCCGGGGGCGTTGGGGGGAGACCTCGGTTGTGGTGTG
AGCGCGGTGCGCTTCGACTTCCCCGCCATGTCGCTCGGCCGGGTGGAGCTGACACGCCTG
CTCGCTGCGTTCGCCCGGGCCGTTCCCGTGGGAGACGCGGTGCACCGGGGACGGGGGCTC
TCATTGCCGCCGGGACTCGACATTGGGAGGCTCTCCACGCACCGCCTTCAGCGGGAGTGG
GAGCGGCTGGTTCCGAAGCACCTCGGGACGCTTGGGGGCGGCAACCACTTCCTGGAGCTG
GATCGCGACGCTGAGGGGGCGCTCTGGCTGTTGCTCCACACAGGCTCGCGGGGCGTGGGG
GCCGCCATCGCCGCGCACCACTTGCGCGTGGCCCAGGTCTCCGGGGAGGGCTCGTTGCCG
GGCCTGCGCACAGACACGTCCGAAGGGGCGGCCTGTCTCGCGGACACGGAGCTGGCCTGT
CAGTTCGCTCGCGCCAACCGCGACACCCTGCTCCAGCGTGCGGTGGAGGTGCTCGCTGGG
GCGATTGGACAGGGGCCCGTGCTGGACTCGCGGGTGGACGTGCACCACAACCACGTCGCC
GCAGAGTCCCACTTCGGCCGCACGTTGCTTGTCCACCGCAAGGGGGCGGTGGGACTGGTC
GCCGGGCAGCAGGGGCTGATTCCCGGCAGCATGGGGACGGCCTCATACCTTGTGGCAGGC
AAGGGCGAGCCCCAGGCGTTCTGCTCGTGCTCGCACGGGGCAGGGCGGGTGATGACGCGC
CGCGAGGCCCGCGAGCGCATCCGCCCGGCGGCTCTGGCGCATGCCCTGCGCCGGGTGGTG
TTCGATGAGGGCCGGGTGACCGCGCTGGTGGAGGAGGCGCCGACCGCCTACCGCGACATC
ACCGAGGTTCTTGAAGACGAGGCGGAGCTGGTAACGCCCCTGCGGCGCCTCACGCCCATC
GCCGTGCTCAAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001233 RtcB family (Family)
 [15-385]  8.70000000000003e-96 PF01139
PF01139   UPF0027
 [13-385]  2.39999798157263e-97 SSF103365
SSF103365   UPF0027
SignalP
 [1-21]  0.887 Signal
Eukaryota   
TMHMM No significant hit