close all open/close all

CDS information : Stigm_00080


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction13,974 / 12,082 / - [in whole cluster]
13,974 / 12,082 / - [in contig]
Locationcomplement(12082..13974) [in whole cluster]
complement(12082..13974) [in contig]
TypeCDS
Length1,893 bp (630 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glycosidase
Product (GenBank)cellulase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)
Family/Domain
FD
IPR001547

close this sectionSequence

selected fasta
>putative glycosidase [cellulase]
MKNSLLLLMLAVLPLYGTAALARPGMANAEPGHFEGPENAGLTAAQCNPRVPLSTRGRYI
VDRCGERFKLKSVNWFGASDQLEVVGGLDKQKLSDLVAGMKAMGFNSVRLPFSNNMLHPD
DNKPAAQRCLEKYSVTCIDSTKNPELLNKTALEVYDAVVAELTRQGLVVILNNHTTKSMW
CCGWDGNGFWDSSQALQRWQDDWVMLAARYQGNKWVAGADLRNEVRPDGLDSPNWGMRNQ
HDWHMAAQTMGNLLLRTNPDLLIVVEAVNWWGLLDGSRPQLKPVRQRPVALLRGDKLVYA
VHNYGYTGPNQSGGSLGSGPKYSDMDKPTLYGTLDQEWGFALAANQAYTAPVWMSEFGVG
YNEQAANSRAWFSNLADYLIEKDVDWAYWAINAAKLQNSVQGEDETYGLWSYPDWNGVRS
GDWRLGTGPLGRLLGADGRTGAVDATRFLPMTVLLKDGSSTYYVDNNSLDSDWHSGKAKI
SCPRGYRMVGVSANFTILCTNAGAVPAQQGTGSYQTITQEVSPLRYPGDWANQSIKFECP
TGFYAVGISTANPFFLELAGLLCEQNTGGIPLNSKSAKNFWGGDQRASSSGGDWSVSQYK
GQCADNQYLIGLAHRRSGLADYPSVVLCSN
selected fasta
>putative glycosidase [cellulase]
ATGAAGAACAGTCTTCTGCTGTTGATGTTGGCGGTGCTCCCCTTGTACGGCACAGCCGCC
CTGGCCCGGCCCGGCATGGCCAACGCCGAGCCAGGCCACTTCGAAGGCCCCGAGAATGCC
GGGCTGACCGCGGCACAGTGCAACCCGCGCGTTCCGCTGAGCACCCGGGGCCGGTACATC
GTCGACCGCTGTGGAGAGCGCTTCAAGCTGAAGTCCGTCAACTGGTTCGGCGCGAGCGAC
CAGCTCGAGGTGGTGGGAGGCCTGGACAAGCAGAAGCTGTCGGACCTCGTCGCAGGAATG
AAGGCGATGGGCTTCAACTCCGTCCGGCTGCCGTTCTCCAACAACATGCTGCACCCGGAC
GACAACAAGCCCGCAGCGCAGCGGTGTCTTGAGAAGTACAGCGTCACATGTATCGACTCC
ACGAAGAACCCGGAGCTGCTGAACAAGACAGCGCTCGAGGTCTACGACGCTGTCGTGGCA
GAGCTGACGCGACAGGGATTGGTGGTCATCCTGAACAACCACACGACGAAGTCCATGTGG
TGCTGCGGCTGGGATGGCAATGGCTTCTGGGACAGCAGCCAGGCCCTGCAGCGGTGGCAG
GACGACTGGGTGATGCTGGCAGCGCGCTACCAGGGCAACAAGTGGGTGGCCGGGGCCGAC
CTGCGCAACGAGGTGCGTCCGGACGGACTGGACAGTCCCAACTGGGGGATGCGCAACCAG
CATGACTGGCACATGGCGGCCCAGACGATGGGCAACCTGCTGCTGCGGACGAACCCGGAC
CTGCTCATCGTCGTCGAGGCAGTCAACTGGTGGGGACTCCTGGACGGATCGCGCCCGCAG
CTGAAGCCCGTGAGGCAGCGGCCCGTCGCCCTGTTGCGCGGAGACAAGCTCGTCTACGCC
GTGCACAACTATGGCTACACCGGGCCGAATCAGTCGGGAGGCTCGCTGGGCAGCGGCCCG
AAGTACAGCGACATGGACAAGCCAACGCTCTACGGCACTCTGGACCAGGAGTGGGGCTTC
GCACTCGCGGCGAATCAGGCGTACACCGCGCCGGTCTGGATGAGCGAGTTCGGCGTCGGC
TACAACGAGCAGGCGGCCAACTCCCGGGCGTGGTTCAGCAACCTCGCGGACTACCTCATC
GAGAAGGACGTCGACTGGGCCTACTGGGCCATCAACGCGGCGAAGTTGCAGAACTCGGTG
CAGGGGGAGGACGAAACCTACGGCCTGTGGAGCTACCCGGACTGGAATGGCGTGCGCAGC
GGTGACTGGCGGCTCGGGACGGGCCCCTTGGGCCGACTGCTCGGAGCGGACGGGCGAACA
GGCGCCGTGGATGCGACGCGCTTCCTACCGATGACCGTCCTCCTGAAGGACGGGAGCTCC
ACCTACTATGTGGACAACAACTCGTTGGACTCCGACTGGCACTCGGGCAAAGCAAAGATC
AGCTGTCCGAGGGGCTATCGCATGGTGGGGGTGAGCGCGAACTTCACCATCCTCTGTACC
AACGCGGGAGCTGTTCCCGCTCAGCAGGGCACGGGGAGCTACCAGACAATCACCCAGGAG
GTCTCTCCGCTGCGCTACCCGGGTGACTGGGCCAACCAGAGCATCAAGTTCGAGTGCCCC
ACGGGCTTCTACGCGGTGGGCATCTCCACGGCGAACCCGTTCTTCCTCGAGCTGGCGGGT
CTGCTCTGCGAGCAGAACACCGGTGGCATTCCTCTCAACAGCAAGTCGGCGAAGAACTTC
TGGGGAGGAGACCAGCGCGCATCCTCCTCGGGAGGCGACTGGAGCGTGAGCCAGTACAAG
GGGCAGTGTGCCGACAACCAATACCTCATCGGATTGGCGCATCGCCGGAGCGGGCTCGCG
GACTACCCGTCGGTGGTGCTCTGCTCCAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001547 Glycoside hydrolase, family 5 (Domain)
 [73-394]  1.09999999999999e-35 PF00150
PF00150   Cellulase
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [51-420]  1.79999999999997e-73 G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [48-433]  1.40000506907309e-60 SSF51445
SSF51445   Glyco_hydro_cat
SignalP
 [1-22]  1 Signal
Eukaryota   
 [1-22]  1 Signal
Bacteria, Gram-negative   
 [1-29]  1 Signal
Bacteria, Gram-positive   
TMHMM No significant hit