close all open/close all

CDS information : Stigm_00100


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction21,463 / 26,220 / + [in whole cluster]
21,463 / 26,220 / + [in contig]
Location21463..26220 [in whole cluster]
21463..26220 [in contig]
TypeCDS
Length4,758 bp (1,585 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)StiB protein
Gene
Gene (GenBank)stiB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)

close this sectionPKS/NRPS Module

2 malonyl-CoA
KS32..407
AT563..876
KR1172..1351
ACP1457..1527

close this sectionSequence

selected fasta
>polyketide synthase [StiB protein]
MSDMMKQLARMIRDLPPDRRAFLADLLRPEPEPIAIVGIGCRFPAGADDPAAFWNLLEQG
VDAISEVPPDRWDLKAFHDPEPEAKGKGNTRWGGFLRKVDEFDPGFFGITPREAIQMDPQ
QRLFIEVAYEAIEDAGIPIERISGTHAGVFVGISGGDYNLIQLASPDQTDAYTCIGAVRS
IIANRLSYLFDLRGPSIVVDTACSSSLVAVHLACQSLRSKECDLAIAGGANLVLSPHWSV
AISKLQALASDGRCKTFDARADGFVRAEGCGTIVLKRLSDALASGDRIRALIRGSATNQD
GHSQGLTAPNGLTQQALLRQALQNGGVKPEQVSYIETHGTGTILGDPIEVSALSEVYGKP
RPDGRPCILGSVKTNVGHLEAAAGIAGLLKVVLALEHGAVPKQLHFQKLNPNISLEGTRF
VIPTEMSPWPSDGQRRMGAVSSFGIGGANAHMVLEEAPSVGPKPPSAVERPRHLLALSAK
TADALRAQAGRFELLLSTVGEEAVPDVCHTAHVGRSHFKHRLAVEGASGAELREHLASFA
AGNETAVAASGKVEEEAHREVAFLFTGQGSQYVDMGRVLYRTQPVFREVINQCSALLGAN
PISLLSVLYPEPGVPTPLDETEFTQPALFALQCALAKLWRSWGIEPSVVMGHSVGEYAAA
CVAGVFNLEEGLRLIAARGRLIQALPAGGAMSAIFTHEAQVAAAVAPLAGRVSIAAINGP
TEVVISGEKAAVEEISERFRGEGVETRRLNVSHAFHSPLMEPVLSAFTKLAEGVTYRTPK
VKLISNLTGQVMSEAPTADAWCRHLRQPVRFLDGLRTLGAMGCGAIIEIGPTPTLIGIGR
RCLPEESMAWLPSLRKGKDDWQQMLSSLGALYTRGLPVNWVGFDKGYSRHRVSVPTYPFQ
RKRYWLAEASADRAVAHGSTRMAVALPGAPDTLHRLEWTPEAQDPLVDRSRGEAERDGGT
WLLLTDQGGVGAALADRLGARGARCLLVSPGEGPLRQEDGVWKVDPSSVGEFTRLLEEGA
NDKGRPLRGIVHLWSLDMPSGLLAAQRLGCGSALHLVQALSRFTQEAGAPRVWWVTRGVH
APGEEASPIAVAQAPIWGLGRVLALEHPELWGGLVDLSPRSGEEEIKALLREFSAPGSGG
QIALRGTSRSVMHLAPCAMPEPSREIHLRADGTYLLTGGLGGLGLRVARWMVEQGARHLV
LVGRRGASEAQQAAIDEMERAGARVLVAQGDISQKDVLAGLLEKARQSMPPLRGVIHAAG
VLDDGVLIRQDWQRFERVMAPKIEGAWNLHELTREVELDFFILFSSMASALGSRGQGNYA
AANAFLDALARLRRSQGLPAVSIQWGPWAEVGMAASHEARALRVWSEKGVGPIQPEEGLR
LLGRAIRSGGTTGPVEVCVIPVQWPVFLEQFTANGIPRWLAGIARKVQGEVKNERAAQPR
LLERIAEAPLLERRAILSAHIGSEVSRIMGFDSSQTINPREGLFAMGMDSLMAVELKNRL
QKELGRTLSSSCVFNYPTLESLTGYLASSVLSREIPTATSEASPPTRTKDSAPTIEPQVD
ALSGTALAELFDEQLSAIDALIDNT
selected fasta
>polyketide synthase [StiB protein]
ATGAGCGACATGATGAAGCAGCTCGCGCGCATGATCCGCGATCTTCCTCCAGATCGGCGT
GCGTTCCTCGCGGACTTGCTGCGCCCCGAGCCGGAGCCGATCGCCATCGTGGGCATCGGC
TGCCGTTTCCCGGCGGGAGCGGATGATCCGGCGGCTTTCTGGAATCTGCTCGAGCAGGGC
GTCGATGCCATCTCGGAGGTTCCGCCCGACCGCTGGGACCTGAAGGCGTTCCATGATCCG
GAACCCGAAGCGAAGGGGAAGGGGAACACGCGCTGGGGTGGGTTCCTGCGGAAGGTGGAT
GAGTTCGATCCGGGCTTCTTCGGAATCACACCGCGCGAAGCCATTCAAATGGATCCGCAG
CAGCGGCTTTTCATTGAAGTGGCGTACGAGGCAATCGAGGACGCGGGCATCCCGATCGAG
CGCATCTCGGGAACCCATGCGGGGGTCTTCGTCGGGATCAGTGGCGGCGACTACAACTTG
ATCCAGCTCGCCAGTCCGGACCAGACCGATGCCTACACGTGCATTGGAGCGGTTCGCAGC
ATCATTGCAAACCGGTTGTCCTATCTGTTCGATCTCCGGGGGCCCAGCATCGTCGTCGAT
ACGGCCTGCTCCTCGTCTCTGGTGGCCGTCCACCTGGCTTGCCAGAGCTTGCGGAGCAAG
GAGTGCGATCTCGCCATCGCGGGCGGGGCCAATCTGGTGCTCTCGCCCCACTGGAGCGTG
GCGATCTCGAAGCTCCAGGCGCTCGCCTCGGACGGGCGGTGCAAGACCTTCGATGCGCGC
GCGGACGGTTTTGTGCGGGCGGAAGGGTGCGGCACCATCGTGCTCAAGCGCCTCTCGGAT
GCACTGGCCTCGGGTGATCGCATTCGTGCACTCATCCGGGGTTCCGCGACCAATCAGGAT
GGCCACAGCCAGGGGCTGACCGCTCCGAACGGTCTCACGCAGCAGGCGCTGCTGCGCCAG
GCCTTGCAGAACGGTGGGGTGAAACCTGAGCAGGTCAGCTACATCGAGACCCACGGCACA
GGAACGATCCTCGGGGATCCCATCGAGGTCAGCGCACTGAGTGAGGTGTATGGCAAGCCG
CGTCCCGATGGACGGCCATGCATTCTCGGCTCGGTCAAGACGAACGTGGGCCATCTGGAA
GCAGCCGCCGGTATCGCGGGGTTGCTGAAAGTAGTGTTGGCGCTCGAGCACGGGGCCGTT
CCAAAGCAACTGCACTTCCAAAAGCTCAATCCCAACATCTCCCTCGAAGGAACCCGGTTC
GTCATTCCCACGGAGATGAGCCCCTGGCCATCCGATGGGCAGCGCCGCATGGGGGCGGTG
AGTTCGTTCGGTATCGGCGGCGCCAACGCGCACATGGTGTTGGAGGAAGCTCCTTCCGTG
GGGCCGAAACCTCCGTCCGCCGTGGAGCGTCCGCGGCACCTGCTCGCGCTCTCCGCCAAA
ACGGCCGATGCCTTGCGAGCGCAGGCGGGGCGATTTGAGCTCCTTCTGTCGACGGTGGGC
GAAGAGGCAGTGCCCGATGTCTGTCATACGGCGCATGTCGGGCGGTCTCACTTCAAGCAC
CGGCTCGCGGTGGAGGGGGCTTCCGGGGCTGAGCTGCGCGAGCACTTGGCCAGCTTCGCG
GCAGGGAATGAGACCGCCGTCGCGGCGTCGGGAAAGGTGGAAGAGGAAGCGCATCGAGAA
GTGGCATTCCTGTTCACGGGCCAAGGATCTCAATACGTGGACATGGGACGTGTGCTGTAT
CGCACGCAACCGGTCTTCCGTGAGGTGATCAACCAGTGCAGCGCGCTGCTCGGTGCGAAT
CCGATCTCGCTGCTCTCGGTGCTCTATCCAGAGCCGGGAGTTCCCACTCCGCTCGATGAG
ACGGAGTTCACCCAGCCCGCGCTCTTCGCCCTCCAGTGTGCGCTCGCCAAGCTGTGGCGG
TCCTGGGGGATCGAGCCTTCGGTCGTCATGGGCCACAGCGTGGGCGAATACGCCGCGGCG
TGTGTGGCCGGCGTGTTCAACCTTGAAGAGGGGTTGCGGCTCATCGCGGCACGTGGGCGG
CTGATTCAGGCCTTGCCCGCTGGCGGCGCGATGAGCGCGATATTCACCCATGAGGCGCAG
GTGGCTGCGGCGGTGGCGCCCCTGGCGGGCCGGGTCTCGATCGCGGCGATCAATGGGCCG
ACGGAGGTCGTGATTTCTGGAGAGAAGGCGGCGGTGGAAGAAATCTCCGAGCGCTTTCGC
GGTGAAGGCGTGGAAACGCGCCGTCTGAATGTCTCACACGCCTTCCATTCGCCTCTCATG
GAGCCGGTGCTTTCGGCGTTCACGAAGCTCGCGGAGGGCGTTACCTACAGGACGCCGAAG
GTCAAGCTCATCTCCAACTTGACCGGGCAAGTCATGAGCGAGGCTCCCACGGCCGACGCT
TGGTGCCGCCACCTTCGCCAGCCGGTCCGGTTCCTGGATGGACTGCGTACCCTCGGCGCG
ATGGGCTGCGGGGCGATCATCGAAATCGGGCCGACGCCGACACTGATCGGCATAGGCCGA
CGGTGCCTGCCCGAAGAGAGCATGGCTTGGCTCCCATCGCTTCGGAAGGGCAAGGACGAT
TGGCAGCAGATGCTCTCCAGCTTGGGCGCGCTCTACACGCGCGGACTGCCCGTCAACTGG
GTGGGCTTCGACAAAGGCTATTCGCGCCATCGCGTTTCGGTGCCGACCTATCCTTTTCAG
CGCAAGCGCTATTGGCTCGCCGAGGCCTCGGCGGATCGTGCCGTGGCACACGGCTCAACC
CGCATGGCGGTGGCCCTGCCGGGCGCACCGGACACGCTCCATCGGCTCGAGTGGACGCCC
GAGGCACAGGATCCATTGGTGGATCGGAGCCGGGGAGAGGCTGAGCGCGATGGCGGAACC
TGGCTCCTCCTCACGGATCAAGGGGGAGTCGGCGCGGCACTGGCGGACCGCCTGGGTGCC
CGTGGGGCGCGATGCCTTCTCGTCTCGCCTGGCGAAGGCCCGCTGCGCCAGGAAGACGGC
GTTTGGAAGGTCGATCCGTCGAGCGTCGGCGAGTTCACGCGGCTTCTCGAGGAGGGAGCG
AACGACAAGGGTCGGCCGCTGCGCGGAATCGTGCACCTTTGGAGCCTGGACATGCCATCG
GGTCTCCTGGCAGCGCAGAGGCTCGGTTGTGGCAGCGCCCTTCATCTGGTTCAAGCACTC
TCGCGATTCACCCAGGAAGCGGGGGCTCCGCGCGTCTGGTGGGTGACGCGAGGCGTGCAT
GCGCCTGGGGAGGAAGCCAGCCCCATCGCCGTGGCGCAAGCGCCGATCTGGGGACTCGGC
CGGGTCCTCGCGCTTGAACATCCCGAGCTATGGGGTGGGCTTGTCGATTTGTCTCCTCGC
TCCGGCGAAGAGGAAATCAAGGCACTGCTTCGCGAGTTCTCTGCGCCTGGCAGTGGCGGC
CAGATTGCGTTGCGTGGGACTTCGCGGAGCGTGATGCACCTCGCGCCTTGCGCGATGCCC
GAGCCCTCGCGCGAGATCCACCTTCGTGCGGATGGCACCTATCTCCTCACGGGAGGTCTC
GGCGGGCTTGGCCTGCGGGTGGCCAGGTGGATGGTGGAGCAGGGCGCACGGCATCTGGTA
CTCGTTGGCCGTCGGGGGGCATCGGAAGCGCAACAAGCCGCCATCGACGAGATGGAGCGC
GCGGGGGCCAGGGTGCTTGTCGCGCAGGGCGACATTTCCCAGAAGGACGTCCTCGCGGGG
CTCCTCGAAAAAGCGCGCCAGTCCATGCCCCCGCTTCGCGGGGTGATCCATGCGGCGGGG
GTTCTCGACGATGGCGTTCTCATCCGGCAGGACTGGCAGCGCTTCGAGCGGGTCATGGCA
CCCAAGATCGAGGGCGCTTGGAACCTGCACGAGCTGACGCGTGAGGTTGAGCTCGACTTC
TTCATCCTGTTCTCGTCGATGGCTTCGGCGCTCGGCTCCCGTGGCCAGGGGAACTACGCG
GCGGCGAATGCGTTCCTGGACGCGCTGGCTCGGCTGCGGCGCTCGCAGGGATTGCCCGCG
GTGAGCATCCAGTGGGGACCCTGGGCAGAGGTGGGAATGGCGGCGAGCCACGAGGCCCGG
GCCCTGCGCGTGTGGTCGGAGAAGGGGGTGGGGCCCATCCAGCCAGAAGAGGGGCTTCGC
CTCTTGGGGCGCGCCATCCGCTCGGGAGGCACCACAGGGCCCGTAGAGGTGTGCGTCATC
CCCGTGCAGTGGCCTGTCTTCCTCGAGCAGTTCACGGCGAATGGGATTCCGCGCTGGCTG
GCGGGCATCGCGCGAAAGGTTCAGGGAGAAGTGAAGAACGAGCGGGCCGCCCAGCCGCGG
CTGCTCGAACGGATCGCAGAGGCCCCCCTTCTCGAGCGCCGCGCCATTCTCTCGGCCCAC
ATTGGGAGCGAGGTCTCCAGGATCATGGGCTTCGATTCGTCGCAGACGATCAATCCACGC
GAGGGCCTCTTCGCCATGGGCATGGATTCGCTCATGGCGGTCGAGTTGAAGAATCGGCTC
CAGAAGGAACTCGGCCGGACGCTCTCCTCGTCGTGCGTGTTCAACTACCCGACCCTGGAG
AGCTTGACCGGCTATCTGGCCAGTTCAGTTCTCTCCCGAGAGATTCCCACGGCCACTTCC
GAGGCTTCGCCGCCGACCAGAACGAAGGACTCCGCGCCGACGATTGAACCGCAGGTTGAC
GCCCTTTCGGGCACGGCGCTCGCCGAGCTCTTCGACGAACAGCTCTCCGCCATCGACGCG
TTGATCGACAACACCTGA
[2] KS32..407
[2] AT563..876
[2] malonyl-CoA753..757
[2] KR1172..1351
[2] ACP1457..1527
[2] KS94..1221
[2] AT1687..2628
[2] malonyl-CoA2257..2271
[2] KR3514..4053
[2] ACP4369..4581

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [554-685]  3.99999999999998e-85 G3DSA:3.40.366.10 [753-867]  3.99999999999998e-85 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [1465-1526]  1.3e-11 PF00550
PF00550   PP-binding
 [1457-1527]  PS50075
PS50075   ACP_DOMAIN
 [1450-1548]  6.30000946287306e-17 SSF47336
SSF47336   ACP_like
 [1462-1529]  9.60000000000001e-14 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1172-1351]  1.29999999999998e-76 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [32-281]  3.49999999999995e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [290-407]  6.40000000000004e-43 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [563-876]  1.10000000000001e-65 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [560-861]  1e-72 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [687-752]  7.79998304125571e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [32-292]  1.99999999999999e-101 G3DSA:3.40.47.10 [293-458]  8.39999999999997e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [24-459]  3.30001976117415e-106 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1171-1380]  1.40000000000001e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [194-210]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [564-858]  2.7000136937899e-118 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1458-1530]  2.10000267834031e-21 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [34-459]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1172-1351]  1.19999063421924e-69 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit