close all open/close all

CDS information : Stigm_00120


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction31,943 / 37,738 / + [in whole cluster]
31,943 / 37,738 / + [in contig]
Location31943..37738 [in whole cluster]
31943..37738 [in contig]
TypeCDS
Length5,796 bp (1,931 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)StiD protein
Gene
Gene (GenBank)stiD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)

close this sectionPKS/NRPS Module

4 methylmalonyl-CoA
KS40..419
AT580..898
OM988..1260
KR1517..1711
ACP1808..1877

close this sectionSequence

selected fasta
>polyketide synthase [StiD protein]
MSTTPNMPEQGEDLGRLKRALTALEKMQAKLDAAERGRTEPIAIIGMGCRFPGGANDPES
YWQNLIQGTDAISEVPPDRWDVDAFFDSNPDTPGKMYTRWGGFLKNWEVDRFDARFFGIA
PREAEAIDPQHRLLLEVSWEAMERAGIAPGGLEGSSTGVFFGLMARDYDILQMKVGDPTR
IDAYYGTGNETSFAAGRLSYLLGLRGPSLVVSTACSSSLVALHMACQSLRGKECNLALAG
GANLILSPEFTIASCRLRSQSPNGRCKSFDAKADGYVRSEGSGVVVLKRLSDAMADGDRI
LAVIRGSAINHDGASSGLTVPSGPAQESLIRAALAAAKVEPHQVSYVEAHGTGTALGDPI
EVRALSETLCKGRDRARPLVLGAVKTNVGHLEAAAGMAGLFKAVLALQHGVVPPNLHFSQ
PTSHIPWDDLPLLVPTQSVPLASGEGRAIVGVSSFGLSGINAHVVLEAAPEPPHAKAAGA
EAGADAAGPVLLPLSARSPDALRVLAEAYVQRVRAPDLRATLQDIAYTAGARRDHFEHRL
ALVATSKEALATQLEGFLRGESIQGLSVGEHSSGAPRKATFIFSGQGSQWVGMGQQLIAS
EPVFRDAIHQVDTALREHVGWSLLDVLAADKERAGFDRVEVVQPVLFAVQVALAALWRSW
GIEPGAVVGHSMGEVAAAHVAGALSLEDAARVIGLRSRLLSRVRGRGGMALVELSLDQVR
ELIRPYEGQLSVGASNGPRSTVLSGDPAALEQVLTSLRRQEVFCRPVDVDVASHSPQMEP
LLPELERGLAVLQPRAAAVPFYSTVLGDVLDGRRLDASYWARNLRSPVLFFQSLQRLIAA
GHELFIEVSPHPVLLPGIEDELRRGSRAGFAVASLRRGEQERSTLLSSLGALYTQGAPVD
WRRIYGSAGRCVPLPSYPWQRQRFWVLGGAEATEARAPVAPAAPSRGAAANGQGNEHPVD
GTPVRFYDALTKARGSAVDESYLTFGVLNEKQPGFSWLRVAYGLDPSEERMRLLLHSQRA
LRNVLLDSVDFSRAKSVWDFGCGYASDIIALGERHSHLKLHGHTLSSEQAELGLRKIEAR
GLGGRVQVLRRDSSKDAPLESAYDVILGFEVATHIKEKRSLFQNLSSHLREGGFMLLADF
IANSGSGVDVQDIASYNVTPSQWVELLSEHGLRLVECVDVSQEVANFLFDADFDANLTQL
ETSVGISAIEKRNYQAMRNFGAALERKILSYVLFIAQKDSHVRSTYLRHINQKWVEAPAP
YAARELMLPGRSGDTAEWLYEINWERKARIARTSTQAQGSVLLLADQAGIARALSTKLTE
QGVRCILVEPGDAYQREEDHFVVRLGEPGDMAQLVKDVAESGGLRAILHLWSLRAAPLGE
TTAATLRKAEKLGCGSTLHLIQALSRTSSRLPPRLWLVTRGAQPVSNAPGTVVVSPAQAP
LWGLGRTLALEVPSLWGGLVDVDSAASASDIAEQLAGEVLHSDGEDQVAFREGARFVARL
VHPAPFKPTPVTLREDASYLITGGLGDLGLKSAAWMVERGVRWLVLVGRTGLPERSKWPE
MDPRSKQGQQIAAVQALEAKGAHVRIAAMDVAEEPRLRMLLSDMRQEGWPAVRGVLHAAG
VANPKPLADLDAEGLQAIFRSKAEGSWALHRVLEGTPLDFFVFFSSGSALMSSPLLGGYA
AANAFMDALAHTRRAQGLPALSINWGFWSEVGMAAREARGLSQGMESFTPDEGLAVLERL
LGQSSPQVGVMRLDVERWIESYPAAGQSPIFSRLRRARVRAASSGPEVPSIREALAALGP
GFRRRSMLEQHVREQLAHVLKMPPAQLGMDTPLHDLGTDSLMAIEIRNRLEKSLELVLPA
TLVFTYPTVAALVVFLSSTMGLPLEAPPEPPRETAEKKDSASTAAELDALSDDEMAARLA
EKLAALNKGRK
selected fasta
>polyketide synthase [StiD protein]
ATGAGCACGACGCCCAATATGCCGGAACAGGGAGAAGATCTCGGACGTCTCAAGCGTGCG
CTGACCGCGCTTGAGAAAATGCAGGCGAAACTCGATGCCGCCGAGCGCGGCCGGACAGAG
CCGATCGCCATTATCGGCATGGGATGCCGTTTTCCCGGCGGCGCCAATGATCCGGAGTCG
TACTGGCAGAACCTGATTCAAGGCACAGACGCCATTTCAGAGGTTCCGCCCGATCGCTGG
GATGTCGATGCATTCTTTGATTCGAATCCCGACACGCCCGGAAAGATGTACACGCGCTGG
GGAGGGTTTCTCAAGAACTGGGAAGTGGATCGGTTCGATGCCCGATTCTTTGGCATTGCT
CCCCGTGAGGCGGAAGCCATCGATCCTCAGCACCGCCTGCTTTTGGAGGTGAGCTGGGAA
GCCATGGAGCGTGCAGGCATCGCTCCGGGCGGTTTGGAGGGGAGCTCGACCGGCGTCTTC
TTCGGGCTCATGGCGAGGGATTACGACATCCTTCAAATGAAGGTGGGAGACCCTACCCGC
ATCGATGCGTATTACGGCACCGGGAACGAGACGAGCTTTGCGGCGGGCCGCCTCTCGTAT
CTCTTGGGCCTGCGCGGCCCCAGCTTGGTGGTAAGCACGGCTTGCTCCTCCTCGTTGGTG
GCTCTGCACATGGCTTGTCAGAGTTTGCGCGGCAAGGAGTGCAATCTGGCGCTGGCCGGT
GGGGCCAACCTGATTCTCTCGCCAGAGTTCACGATTGCCTCCTGTCGTCTTCGCTCTCAG
TCGCCAAATGGCCGCTGCAAGAGCTTCGACGCGAAGGCCGATGGCTATGTGCGCAGTGAG
GGATCCGGCGTCGTCGTGCTCAAGCGGTTGTCGGACGCCATGGCGGATGGAGACAGGATT
CTCGCGGTCATCCGAGGCTCCGCCATCAACCATGACGGTGCGAGCAGTGGGTTGACCGTT
CCGAGTGGCCCCGCGCAAGAGTCGCTCATTCGCGCGGCCTTGGCTGCCGCCAAGGTTGAG
CCCCATCAGGTCTCTTATGTGGAGGCGCATGGTACGGGGACCGCGCTCGGCGATCCGATC
GAAGTGCGTGCCTTGAGCGAGACCCTGTGCAAGGGGCGTGATCGCGCACGGCCGTTGGTA
CTCGGTGCCGTGAAGACGAACGTCGGGCATCTCGAGGCCGCCGCCGGTATGGCAGGCCTG
TTCAAAGCCGTTCTCGCGCTCCAGCACGGGGTGGTGCCGCCCAATCTGCATTTCTCGCAG
CCGACCTCCCATATTCCTTGGGACGATCTACCGCTGCTCGTGCCGACGCAGTCGGTTCCG
CTTGCCTCGGGAGAGGGGAGGGCCATTGTCGGCGTCAGTTCTTTTGGGCTGAGTGGGATC
AACGCGCACGTGGTGCTGGAGGCGGCTCCGGAGCCGCCTCACGCGAAGGCGGCCGGAGCG
GAAGCCGGAGCCGACGCTGCGGGACCTGTCCTCCTGCCGTTGTCGGCGCGCAGCCCGGAC
GCGTTGCGCGTGTTGGCGGAAGCGTATGTGCAGCGGGTGCGCGCCCCGGACCTGCGCGCG
ACGCTTCAGGACATCGCCTATACCGCAGGGGCCCGGCGCGACCACTTCGAACACAGGCTC
GCGTTGGTGGCCACGTCGAAGGAAGCGCTTGCCACACAGCTCGAAGGTTTCCTTCGTGGA
GAGTCGATCCAGGGCCTGTCCGTGGGGGAGCATTCGTCCGGGGCCCCGCGCAAGGCCACG
TTCATCTTTTCCGGCCAGGGGTCGCAGTGGGTTGGAATGGGCCAGCAACTGATCGCCTCC
GAGCCTGTATTCCGGGACGCGATCCACCAGGTGGACACGGCCTTGCGCGAGCACGTGGGC
TGGTCGCTTCTGGACGTCCTGGCCGCCGACAAAGAGCGTGCAGGTTTCGATCGGGTCGAG
GTCGTTCAGCCCGTGCTGTTCGCGGTGCAGGTGGCGCTCGCGGCGCTCTGGCGTTCGTGG
GGGATCGAGCCCGGCGCCGTGGTGGGGCATAGCATGGGCGAGGTCGCGGCGGCCCACGTG
GCGGGTGCGCTGTCGCTGGAGGATGCCGCGCGGGTCATCGGTTTGAGGAGTCGGCTCCTC
AGTCGCGTGAGGGGTCGGGGTGGTATGGCGCTGGTCGAGCTCTCTCTCGACCAGGTGCGT
GAGCTTATTCGTCCTTACGAGGGGCAGCTCTCCGTCGGGGCCAGCAATGGTCCGAGGTCC
ACCGTTCTCTCGGGGGATCCCGCCGCGCTCGAGCAGGTCCTCACCTCCTTGCGGCGCCAG
GAGGTTTTCTGTCGTCCGGTCGATGTCGATGTCGCCTCTCACAGCCCGCAGATGGAGCCC
CTGCTTCCGGAACTCGAGCGGGGGTTGGCGGTCCTCCAACCGCGCGCCGCTGCCGTGCCG
TTCTATTCGACAGTGCTGGGCGACGTGCTGGATGGCCGACGCCTCGACGCATCTTATTGG
GCGCGGAATCTGCGGTCTCCGGTGCTCTTCTTCCAGTCCCTGCAGCGGTTGATCGCGGCG
GGTCACGAGCTGTTCATCGAGGTGAGCCCTCATCCGGTGTTGTTGCCGGGGATCGAGGAC
GAGCTGCGCCGTGGTAGTCGCGCGGGCTTCGCGGTGGCTTCGCTTCGGAGAGGGGAGCAG
GAGAGGAGCACACTGCTCTCTTCTCTCGGAGCCCTGTACACCCAGGGCGCACCGGTGGAC
TGGCGTCGGATCTACGGCAGTGCCGGGCGTTGCGTTCCCTTGCCCTCGTACCCCTGGCAG
AGACAGCGTTTTTGGGTCTTGGGAGGAGCGGAGGCAACCGAGGCGCGGGCACCTGTTGCC
CCAGCGGCTCCGTCGCGAGGGGCGGCAGCCAATGGCCAGGGGAATGAGCACCCGGTGGAT
GGAACGCCTGTGCGTTTCTATGACGCGCTGACGAAGGCGCGTGGCTCCGCCGTGGATGAG
TCCTATCTGACCTTCGGCGTGCTGAATGAAAAGCAGCCGGGCTTCTCGTGGCTGCGTGTG
GCCTACGGCCTCGATCCATCCGAAGAACGCATGCGCCTGTTGCTTCACTCGCAGCGAGCC
TTGCGGAATGTGCTGCTCGACAGCGTTGATTTCTCCCGCGCCAAGTCGGTGTGGGATTTT
GGGTGTGGCTACGCGTCGGACATCATTGCCCTGGGCGAGCGTCATTCTCACCTCAAGCTG
CATGGCCATACGCTCTCGAGTGAGCAGGCGGAGCTCGGACTTCGAAAGATCGAAGCCCGG
GGGCTTGGCGGGCGTGTTCAGGTGCTTCGCCGAGACAGCAGCAAAGACGCTCCCCTGGAG
AGCGCGTACGACGTGATCCTCGGTTTCGAGGTGGCGACGCACATCAAGGAAAAGCGTTCG
CTGTTCCAGAACCTGTCGAGCCACCTCCGCGAGGGTGGCTTCATGCTCCTGGCGGATTTC
ATCGCGAACTCGGGCTCAGGCGTGGATGTGCAGGACATCGCCTCGTACAACGTCACGCCC
AGCCAGTGGGTGGAACTGCTGAGCGAGCACGGGCTGCGGTTGGTTGAATGCGTGGATGTC
AGCCAGGAGGTCGCGAACTTCCTCTTTGATGCGGACTTCGATGCCAACCTGACCCAGCTC
GAGACATCGGTGGGGATCAGCGCCATCGAGAAGCGCAACTATCAGGCGATGCGGAACTTC
GGGGCGGCGTTGGAGCGGAAGATCCTCTCCTACGTTCTGTTCATTGCCCAGAAGGACTCG
CACGTTCGAAGCACCTACTTGCGTCACATCAACCAGAAATGGGTCGAAGCACCTGCGCCG
TATGCGGCTCGAGAGTTGATGCTTCCGGGCCGAAGCGGTGACACGGCGGAGTGGCTGTAC
GAGATCAACTGGGAACGCAAGGCCCGTATTGCCCGGACCTCGACCCAGGCCCAGGGAAGT
GTTCTGCTCCTCGCGGATCAGGCAGGCATCGCACGAGCCCTCTCCACGAAGCTGACGGAG
CAGGGGGTGCGGTGCATCCTGGTGGAGCCCGGTGATGCCTATCAGCGGGAGGAAGACCAC
TTCGTGGTCCGCCTGGGTGAACCGGGCGACATGGCCCAGTTGGTGAAGGATGTGGCCGAA
TCCGGAGGCCTTCGCGCGATCCTCCACCTGTGGAGTCTCCGCGCCGCGCCTCTTGGTGAG
ACCACTGCCGCGACGCTGCGCAAGGCGGAGAAACTGGGGTGTGGGAGCACGCTCCATCTC
ATTCAGGCGCTGTCCCGCACGAGTTCGCGGCTGCCGCCACGTCTCTGGCTCGTCACGCGG
GGGGCTCAGCCGGTGAGCAACGCACCCGGGACCGTTGTCGTGTCCCCCGCTCAAGCGCCG
CTGTGGGGTTTGGGCCGCACCCTGGCCTTGGAGGTGCCGTCCCTGTGGGGAGGGCTCGTG
GATGTGGATTCCGCTGCATCTGCGTCCGACATTGCCGAGCAGCTCGCAGGAGAGGTGCTG
CACTCGGATGGCGAAGATCAGGTCGCCTTCCGTGAGGGGGCGCGGTTCGTCGCGCGCTTG
GTGCATCCGGCTCCGTTCAAGCCCACTCCCGTGACGCTGCGTGAGGATGCGAGCTACCTG
ATCACCGGTGGTCTCGGTGATCTGGGGTTGAAGAGCGCGGCTTGGATGGTCGAGCGAGGC
GTCCGGTGGCTCGTGTTGGTGGGCCGTACTGGGCTCCCCGAGCGTTCCAAGTGGCCGGAG
ATGGATCCTCGGAGCAAACAGGGGCAGCAGATTGCCGCCGTGCAGGCGCTAGAGGCGAAG
GGTGCACACGTCCGGATCGCTGCCATGGATGTGGCCGAGGAACCTCGGTTGCGCATGCTG
CTGTCGGACATGCGTCAGGAGGGGTGGCCCGCCGTTCGAGGGGTGTTGCACGCGGCCGGT
GTGGCGAATCCCAAGCCGCTCGCAGACCTCGATGCCGAGGGGCTGCAGGCGATCTTCCGA
TCGAAGGCGGAGGGAAGCTGGGCGCTGCATCGCGTTCTCGAGGGGACGCCGCTCGACTTC
TTCGTCTTTTTCTCCTCGGGTTCCGCGCTCATGAGTTCGCCCTTGCTGGGTGGCTATGCG
GCGGCGAACGCCTTCATGGATGCGCTCGCGCACACCCGGCGTGCGCAGGGTCTACCCGCG
CTGAGCATCAACTGGGGGTTCTGGTCCGAGGTGGGAATGGCAGCCCGGGAAGCTCGGGGC
CTTTCGCAGGGCATGGAGAGCTTCACCCCCGACGAGGGATTGGCGGTTCTCGAGCGGTTG
CTCGGGCAGTCGTCTCCCCAGGTAGGGGTGATGAGGCTCGATGTCGAGCGCTGGATCGAG
TCCTACCCGGCTGCTGGCCAGTCACCGATCTTCTCGCGGCTGAGGCGCGCCCGTGTGCGG
GCGGCGTCTTCCGGACCTGAGGTTCCCAGCATTCGCGAGGCCCTTGCCGCCCTCGGTCCT
GGTTTCCGTCGACGCTCGATGCTCGAGCAGCACGTGCGCGAGCAACTCGCTCACGTGTTG
AAGATGCCGCCCGCGCAGCTCGGCATGGACACGCCGCTGCATGACCTGGGCACGGACTCG
TTGATGGCCATCGAAATCCGCAACCGTCTCGAGAAGAGTCTCGAGCTCGTGTTGCCCGCG
ACCCTGGTCTTCACTTACCCGACGGTCGCCGCACTCGTCGTTTTCCTGTCCAGCACCATG
GGGTTGCCGCTCGAAGCGCCGCCTGAGCCGCCACGCGAAACGGCAGAGAAGAAGGACTCT
GCCTCAACCGCTGCGGAACTCGACGCGCTCTCCGACGATGAAATGGCCGCTCGCCTGGCT
GAAAAGCTGGCAGCTCTCAACAAGGGACGGAAGTGA
[4] KS40..419
[4] AT580..898
[4] methylmalonyl-CoA771..775
[4] OM988..1260
[4] KR1517..1711
[4] ACP1808..1877
[4] KS118..1257
[4] AT1738..2694
[4] methylmalonyl-CoA2311..2325
[4] OM2962..3780
[4] KR4549..5133
[4] ACP5422..5631

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [573-703]  2.50000000000001e-77 G3DSA:3.40.366.10 [771-888]  2.50000000000001e-77 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1518-1698]  2.29999999999998e-50 PF00106
PF00106   adh_short
IPR009081 Acyl carrier protein-like (Domain)
 [1801-1879]  2.60000517657733e-20 SSF47336
SSF47336   ACP_like
 [1808-1877]  PS50075
PS50075   ACP_DOMAIN
 [1805-1879]  5.30000000000001e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1812-1873]  8.5e-12 PF00550
PF00550   PP-binding
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [40-293]  3.79999999999991e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [301-419]  1.2e-44 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [580-898]  2.70000000000002e-100 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [578-880]  5.10003242202156e-69 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [705-770]  5.00000909915354e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [42-305]  7.79999999999999e-101 G3DSA:3.40.47.10 [306-472]  5.00000000000001e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [32-417]  2.99998750445706e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1516-1717]  1e-30 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [206-222]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [582-879]  3.49999466863949e-124 SM00827
SM00827   PKS_AT
IPR020803 Polyketide synthase, methyltransferase domain (Domain)
 [988-1260]  SM00828
SM00828   PKS_MT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1809-1880]  3.69999438558106e-25 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [42-471]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1517-1711]  4.60000044330862e-55 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit