close all open/close all

CDS information : Stigm_00150


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction50,205 / 54,401 / + [in whole cluster]
50,205 / 54,401 / + [in contig]
Location50205..54401 [in whole cluster]
50205..54401 [in contig]
TypeCDS
Length4,197 bp (1,398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)StiG protein
Gene
Gene (GenBank)stiG
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)

close this sectionPKS/NRPS Module

7 methylmalonyl-CoA
KS37..413
AT577..890
DH945..1114
ACP1275..1345

close this sectionSequence

selected fasta
>polyketide synthase [StiG protein]
MSKPANPVEQLSPLQQALLALREMRAKLDASERARTEPIAVVGMGCRVPGGASNAELLWA
LLRDGVDAISEVPADRWDLKDYYDPDPDAVGKMYTRHGGFVDAIDRFDAQFFGIAPKEAS
RMDPQQRLLLEVTWEALEHAGIAVDRLTGSSTGVFVGLCNNDYSFLHMRSGAGDAPDTYS
ATGSALSIASGRISYLLGLQGPCMTVDTACSASLLTVHLACQSLRQRECNLALAGGVNAI
LLPEGTVSGCQLRALAPDGRCKTFDAAANGYVRSEGCGMVVLKRLSDALADGDDILAVIR
GSAVNQDGRSGGLTAPNGPAQEDVIRKALARAGVEPKQVGYVEAHGTGTSLGDPIEVRAL
GAVLGAGRSKEQPLLLGSIKTNVGHLEGAAGIAGLLKVVLMLKHGEIPPHLHLSRPNPYI
SWDELPLAIPARRIPWAPIDGRRIAGVSSFGLSGTNVHVVLEAAPPRTAATSGPAAPRSE
SDLFHLLPLSARTKGALESLAKEYLGLLSQEAPAAAPLLQDVCRSASVRRSHHEHRLAVV
GKTHAELSEQLQNFLRGETLAGLSTGYTVPGERRKVVFIFPGQGSQWVGMGRKLLAQEPV
FRAAIERCDEEMRTHLNGSLLEALRDGSAALPLDRIDVLQPALFAFEVALAALWRSWGIE
PDAVIGHSMGEVAAAHVAGILSLPDAVRIICQRSKLLRRVSGQGAMAVVALSMEAVRREL
AGYEDRLAVAVSNSPASTVISGDPTVLRELLGRFKERDIFCREVKVDVASHSPQMDPLRG
ELLQALTGISARPASVPFYSTVKDRLVEGSELDVAYWADNLREPVLFGNAVQGLLSEGHE
IFLELSPHPILLTPVEEILHASGRQGAALPSVRRDAPEQATLLASLGSLYSLGASVDWMK
LATDGQFVRLPSYPWQRQRFWHPAAELAPRARVERGGRQESEQGHPLLGGYLPLARPEGT
HAWEIVLDPEAQPFLFEHRIKGAALLPGSVFLEMALAAAKEALGWQPLVVSEMELHRALV
LPKHGTCAVQLLIEPVREGRAGFQIYGRASASESWSLHVTGTLREKHGELESLTKEELAL
SAIEARCDTEVPGERFYERIASMGVQLGSSQQLIEHLRQREGEALASLRIPDGLVSELST
YVLHPSLVDACFQLFGAMSMASGTQESGDFVHLPVHLGGVQVVRRPEGRLWAHARLDLEA
SDGELPSGSVRLLDETGKTLVLMKGVRFMRVHREALEAQASPDAASSAPGQEAPGRARIA
HLVAGAPAARRRGLLLAEVCSDVCGVLGFDPAAPLETRLGFFKMGMDSLTAMKLRKRLEV
GIGKSLPPTLVFEYPNIEQLTDFLGRELAIHSAAPENTPVGNPSRGIPDELEGLPEEELI
ALFDREMAALERTSGEKS
selected fasta
>polyketide synthase [StiG protein]
ATGAGTAAACCGGCCAATCCCGTCGAGCAGTTGTCTCCGTTGCAGCAAGCGCTGCTCGCG
CTCCGTGAAATGCGCGCGAAGCTCGATGCTTCGGAGCGCGCTCGCACCGAGCCCATCGCC
GTCGTCGGGATGGGATGCCGCGTCCCTGGCGGCGCGAGCAATGCAGAGCTGCTCTGGGCA
TTGCTCCGCGATGGTGTGGACGCGATCTCCGAAGTCCCGGCTGATCGCTGGGACCTCAAG
GATTACTACGACCCGGATCCCGACGCCGTGGGCAAGATGTACACGCGTCACGGAGGGTTC
GTTGACGCCATCGATCGCTTCGATGCGCAGTTCTTCGGGATTGCTCCGAAGGAAGCCAGC
CGGATGGACCCGCAGCAGCGTCTGCTGCTCGAGGTGACGTGGGAGGCGCTGGAGCACGCG
GGGATCGCTGTCGATCGGCTCACGGGCTCGTCGACCGGCGTCTTCGTGGGGCTTTGCAAC
AACGACTATTCCTTCCTCCATATGCGCTCGGGCGCTGGCGACGCGCCCGATACGTATTCG
GCCACTGGAAGTGCCCTCAGCATTGCCTCGGGACGCATCTCGTACCTGCTCGGTCTGCAA
GGCCCTTGCATGACCGTGGACACCGCGTGTTCCGCGTCACTTTTGACCGTTCACCTTGCG
TGTCAGAGCCTGCGCCAGCGCGAGTGCAACCTCGCCTTGGCTGGCGGCGTCAATGCCATC
CTTCTCCCAGAAGGCACGGTCAGTGGTTGCCAGCTTCGGGCCCTCGCGCCTGATGGGCGG
TGCAAGACGTTCGACGCCGCGGCGAACGGCTATGTGCGGAGTGAAGGGTGCGGAATGGTG
GTGCTCAAGCGCCTTTCCGACGCCCTCGCGGATGGGGATGACATCCTCGCCGTCATCCGG
GGCTCCGCCGTCAATCAAGACGGACGCAGCGGTGGGCTCACGGCACCCAATGGTCCGGCA
CAGGAAGATGTGATTCGCAAGGCTCTGGCTCGGGCTGGCGTCGAGCCCAAGCAGGTGGGC
TATGTCGAGGCTCACGGGACGGGCACTTCGCTCGGCGATCCGATCGAAGTCCGTGCGCTG
GGCGCGGTTCTCGGGGCGGGGCGCTCAAAAGAGCAGCCGCTGTTGCTGGGTTCGATCAAA
ACCAACGTGGGGCACTTGGAGGGGGCGGCGGGCATCGCGGGTCTGCTCAAAGTGGTGTTG
ATGCTGAAGCACGGCGAGATCCCGCCCCACCTGCACCTGTCACGGCCGAACCCCTATATC
TCCTGGGACGAACTCCCCCTGGCCATTCCGGCCAGGCGGATTCCCTGGGCGCCCATCGAC
GGCCGACGAATCGCCGGCGTGAGTTCGTTCGGGCTCAGCGGGACCAATGTTCACGTCGTG
CTCGAAGCAGCTCCGCCGCGCACGGCGGCCACTTCGGGCCCTGCCGCGCCTCGTTCTGAG
TCGGACTTGTTCCACTTGTTGCCGCTGTCCGCGCGGACGAAAGGCGCACTCGAGTCCCTC
GCCAAGGAATATCTCGGGCTGCTCTCTCAGGAAGCTCCTGCAGCCGCCCCGCTGCTTCAG
GACGTCTGCCGTTCCGCCAGCGTCCGGCGCAGCCACCACGAGCATCGGTTGGCTGTTGTG
GGAAAAACGCACGCGGAGCTCTCCGAACAGCTCCAAAACTTCCTCCGGGGAGAGACTCTG
GCTGGGCTTTCGACCGGATACACGGTTCCCGGCGAGCGGCGGAAGGTCGTTTTCATCTTC
CCCGGACAAGGTTCGCAGTGGGTTGGCATGGGACGAAAGCTCCTCGCGCAGGAGCCCGTG
TTCCGTGCCGCCATTGAACGGTGCGACGAGGAGATGCGGACGCACCTCAACGGTTCGCTT
CTGGAGGCGTTGAGGGACGGTTCGGCTGCCCTGCCGCTGGATCGAATCGATGTCCTCCAG
CCCGCTTTGTTCGCGTTCGAAGTCGCCCTCGCCGCGCTTTGGCGCTCCTGGGGCATCGAG
CCGGATGCCGTCATCGGTCACAGCATGGGAGAGGTGGCCGCAGCACACGTCGCGGGCATC
CTGAGCCTTCCGGACGCGGTGCGGATCATCTGCCAGCGCAGCAAGCTCCTGAGAAGGGTG
AGCGGGCAGGGGGCCATGGCGGTCGTGGCGCTGTCGATGGAAGCCGTTCGCCGGGAGCTT
GCCGGGTATGAGGACCGGTTGGCCGTGGCCGTCAGCAACAGTCCTGCCTCCACCGTCATC
TCGGGAGATCCGACGGTGCTTCGCGAGCTTCTGGGTCGCTTCAAGGAACGCGACATCTTC
TGCCGTGAGGTGAAGGTCGACGTTGCGTCGCACAGCCCCCAGATGGATCCCCTCCGGGGG
GAGTTGCTCCAAGCCCTGACCGGAATCTCCGCCCGCCCCGCGTCCGTGCCCTTCTACTCG
ACCGTCAAGGATCGGCTCGTGGAAGGCTCCGAACTCGACGTGGCCTACTGGGCAGACAAC
CTGCGCGAGCCCGTGCTTTTTGGCAACGCGGTGCAGGGGTTGCTTTCCGAAGGGCACGAG
ATTTTCCTGGAGCTCAGCCCGCATCCCATTCTGCTCACGCCCGTGGAGGAGATTCTTCAC
GCCTCGGGGCGGCAGGGGGCGGCGCTTCCTTCCGTCCGGCGCGATGCACCCGAGCAGGCG
ACGTTGCTCGCGTCTCTGGGGTCGCTGTACTCGCTCGGTGCGTCCGTGGACTGGATGAAG
CTGGCCACGGACGGCCAATTCGTCCGGTTGCCCTCGTATCCCTGGCAGCGGCAGCGCTTC
TGGCATCCCGCGGCGGAATTGGCTCCACGCGCTCGCGTGGAGCGGGGGGGGCGCCAGGAG
TCGGAGCAGGGTCACCCCCTTCTCGGTGGGTATCTGCCCCTGGCTCGGCCTGAGGGCACC
CATGCCTGGGAGATCGTTCTCGACCCCGAGGCTCAGCCTTTCCTCTTCGAGCACCGGATC
AAGGGGGCCGCGCTGCTCCCTGGCTCGGTGTTCCTGGAGATGGCGCTTGCCGCGGCAAAA
GAGGCGCTGGGTTGGCAACCCCTGGTGGTTTCGGAGATGGAGCTCCATCGCGCACTCGTC
CTGCCGAAGCACGGCACGTGCGCTGTCCAGCTCTTGATCGAGCCGGTGCGAGAAGGGCGT
GCGGGTTTCCAGATCTATGGCCGCGCATCCGCGTCCGAATCGTGGAGCTTGCACGTGACC
GGCACGCTCCGGGAAAAGCACGGGGAACTCGAGTCCCTCACGAAGGAAGAACTCGCGCTG
AGCGCGATCGAAGCGCGATGCGACACCGAGGTGCCGGGCGAGCGCTTCTACGAGCGAATT
GCTTCCATGGGGGTCCAGCTCGGTTCCTCGCAGCAACTCATCGAGCACCTCCGTCAGCGT
GAGGGGGAGGCACTGGCATCCTTGCGCATTCCGGATGGGCTCGTGTCGGAACTCTCCACC
TACGTGCTCCACCCGAGCCTCGTCGATGCCTGCTTCCAGCTCTTTGGCGCGATGTCGATG
GCGTCAGGCACGCAGGAGTCAGGGGACTTCGTCCATCTGCCTGTCCACCTGGGAGGAGTG
CAGGTCGTGCGGCGTCCCGAAGGCCGACTTTGGGCTCATGCCCGTTTGGATCTCGAAGCG
TCGGATGGTGAGCTCCCCTCGGGCAGCGTCCGCCTGCTCGATGAGACTGGCAAGACGCTG
GTGTTGATGAAGGGCGTTCGGTTCATGCGCGTCCACCGGGAGGCGCTTGAGGCCCAGGCT
TCGCCGGATGCTGCTTCGTCCGCGCCGGGTCAGGAAGCGCCTGGACGTGCTCGGATCGCC
CACCTTGTCGCAGGGGCTCCAGCGGCACGGCGTCGCGGCCTGTTGCTCGCAGAGGTCTGC
TCCGATGTCTGCGGTGTGCTCGGCTTCGATCCGGCGGCTCCCTTGGAGACGCGCCTCGGC
TTCTTCAAGATGGGCATGGATTCGCTGACGGCGATGAAGCTCCGGAAGCGCCTCGAAGTG
GGCATTGGAAAGTCGCTGCCTCCCACCCTGGTTTTCGAATATCCCAACATCGAGCAGCTC
ACGGACTTCCTCGGGCGAGAACTCGCCATCCACTCCGCGGCGCCCGAGAACACGCCGGTG
GGGAACCCTTCCCGTGGCATCCCGGATGAACTGGAAGGGCTTCCGGAAGAGGAGCTCATC
GCGCTGTTCGATCGCGAAATGGCCGCCCTCGAGCGGACCTCTGGAGAGAAGTCATGA
[7] KS37..413
[7] AT577..890
[7] methylmalonyl-CoA768..772
[7] DH945..1114
[7] ACP1275..1345
[7] KS109..1239
[7] AT1729..2670
[7] methylmalonyl-CoA2302..2316
[7] DH2833..3342
[7] ACP3823..4035

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [568-700]  8.90000000000015e-78 G3DSA:3.40.366.10 [768-884]  8.90000000000015e-78 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1303-1318]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1275-1345]  PS50075
PS50075   ACP_DOMAIN
 [1266-1347]  3.60000000000001e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1279-1344]  3.7e-10 PF00550
PF00550   PP-binding
 [1267-1362]  1e-14 SSF47336
SSF47336   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [37-288]  5.00000000000001e-100 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [296-413]  1.70000000000001e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [577-890]  9.9e-97 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [575-877]  9.20006495413779e-71 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [702-767]  2.19999900980708e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [39-300]  8.39999999999977e-103 G3DSA:3.40.47.10 [301-467]  2.39999999999997e-66 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [29-412]  8.70005082121738e-108 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [201-217]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [579-876]  2.7000136937899e-122 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1276-1348]  1.10000150671642e-21 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [945-1114]  1.10000150671643e-44 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [39-466]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit