close all open/close all

CDS information : Stigm_00160


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction54,398 / 59,212 / + [in whole cluster]
54,398 / 59,212 / + [in contig]
Location54398..59212 [in whole cluster]
54398..59212 [in contig]
TypeCDS
Length4,815 bp (1,604 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)StiH protein
Gene
Gene (GenBank)stiH
EC number
Keyword
  • iterative
Note
Note (GenBank)
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)

close this sectionPKS/NRPS Module

8 malonyl-CoA
KS37..411
AT569..888
kr1199..1380
ACP1483..1553

close this sectionSequence

selected fasta
>polyketide synthase [StiH protein]
MSESAQPIDYPARLRRALRVVRELQAELKSGRRARAEPIAIIGVGCRLPGGIEGPEAYWK
ALREGVDAISEVPPDRWPIDAYFDPNPETPGKMYARFGGFLDQVDRADMRFFGLSPRQAA
STDPQQRMFLEVCWAALEHAGIPPDRLSGQLGGVFVGVNGNDYALLRAGDPAGLDAYSGS
GNTNSAVAGSVSYVLGLHGPSLSVDTACSSSLVSVHLACQSLRLGECDIALAGGVNLIMS
PNGTIALSRTRVLSPDGRCKAFDASADGMGRGEGCGAVVLKRLSDAITDGDRILATIRGS
AVNQDGTSSGVTVPNGMAQQALLRRALANANIEAPQMGYLEAHGTGTSLGDPIEMRAVAT
VLCEGRSQEQKLIVGSVKTNFGHLEAAAGIAGLIKVALSLHHQEIPAHLHLKKPNPLIPW
ETLPVTIPTQRISWPVADGQRRIAGVSSFGMSGTNSHVILEEAPPQEPVAPSAQVERPCH
LLGLSAKGDEALKALAVRYERLLAEQPELSLPDLCHGANTGRTHFSHRLAVVAESQAQLR
EQLAAFIGGQKGQGLVARSVPSGREPELVFLFTGQGSQYAGMGRQLYETQPVFRQTLDQC
DALLQPHLGRSLLSVLYPEPGSRTPLDETAFTQPALFAIEYALAMLWQSWGIQPTAVMGH
SVGEYVAACVAGVFSLEDGLRLIAERGRLMQALPPDGDMAAVFAEEARVVEAIAPFSSQL
SIAAVNGPTETVISGEKGALAAVLERLSAQGIQARRLNVSHAFHSPLMQPIVDTFAGVVA
SVTFHPPQFELISNVTGRPADPQLLSSSEYWCRHLLAPVRFWDSLQSLHQRGSRLFLEIG
PGATLASMGRRGFSQDGSCLWLSSLQKDRGDWTHLLRALGELYASGLKVDWQAFDQGYTR
HHVTLPTYPFQRERHWFKLSRSSAIQPVAAVGARDLGPSPESGEAELPGDWLYELEWKPW
VASVPVPERANSPRQWLIFADRHGLGAALAERIEQRGERCVLVSPAQAGSGGEGTSGSAT
SRRMSVDPQNSADYRRVIQEAFAEGSEPAAVVHLWGLDAESVEGKDSAALEEGQHLGQNS
VLILLQALSAVGRGTPRLWAVTRGAALVGSGKPSLVQAPIWGLGRVLAIEHPSLWGGLVD
LDPAAGATAGDVTALLGEFEAPEGEDQVAWRGGQRLVPRLRPQRLPEQQGRAPRLKAEAT
YLVSGALSGSLLEVSRWMVERGARHLVLAGLEQSEVGALSEALSALESRGAHLQFLSRDE
MLQSPEALTGLFSSLRESNRPLRGVLHAGGAWTPRASRDLGPGELQSALRSEVVLPWALH
EQVAGEELEFFILFSSVASVWGSGGLSHHAAAHHVLDALAHQRRALGLPALVVNFGQWAQ
VGVLPEEAYRMSARSGVDALPPATALAVLEPLLEAGGTQRTIASVRWNVFKPILEMGRAR
PMLADIDARDPQRGDVVDDAVERARKLKEALGEALPNERHEVLQAYLQGDVASVLGYENP
GDIEPTAGFFDLGMDSIMAMDLKTRLERGMERTFPSTMAFEHPTIDALARYLSKEVFATL
FEEAPRATTPEPVSNDDDARWDALDELSEDQVASLLAERLNAIE
selected fasta
>polyketide synthase [StiH protein]
ATGAGTGAGTCGGCTCAACCCATTGACTATCCCGCACGTTTGCGTCGTGCGTTGAGGGTG
GTCCGGGAGCTTCAGGCCGAACTCAAATCGGGTCGGCGGGCCAGGGCGGAACCCATCGCC
ATCATTGGTGTGGGGTGCCGCTTGCCCGGAGGCATCGAGGGTCCGGAGGCCTATTGGAAA
GCCTTGCGGGAAGGTGTGGATGCCATCTCCGAGGTGCCCCCGGATCGCTGGCCCATCGAT
GCCTATTTCGATCCAAACCCGGAAACGCCCGGCAAGATGTATGCGCGCTTCGGAGGCTTC
CTCGACCAGGTAGACCGGGCGGACATGCGCTTCTTTGGGCTCAGCCCCCGTCAGGCCGCG
AGCACCGATCCGCAGCAGCGGATGTTCCTCGAGGTCTGCTGGGCGGCGCTCGAGCACGCA
GGGATTCCTCCGGATCGGCTCTCGGGTCAGTTGGGGGGCGTCTTCGTCGGCGTCAATGGC
AATGACTACGCGCTGCTTCGCGCGGGCGATCCGGCAGGGCTCGACGCCTATTCTGGCTCT
GGCAACACCAACAGCGCCGTGGCGGGGAGCGTGTCCTATGTGCTCGGTCTGCACGGCCCC
AGTCTGTCGGTGGACACGGCTTGTTCCTCATCGCTGGTCTCGGTGCACCTGGCCTGTCAG
AGCCTGCGCCTGGGGGAGTGCGATATCGCCCTGGCCGGCGGGGTGAACCTCATCATGTCC
CCCAACGGGACGATTGCCCTGTCTCGAACGCGGGTTCTTTCCCCCGACGGCCGGTGCAAG
GCCTTCGACGCGTCCGCCGACGGAATGGGGAGAGGGGAGGGGTGTGGCGCCGTCGTCCTC
AAACGGCTCTCTGATGCGATCACGGATGGGGATCGGATTCTCGCGACCATTCGTGGCTCG
GCGGTCAATCAGGACGGGACGAGCAGCGGCGTCACGGTTCCCAATGGCATGGCGCAGCAG
GCGCTGCTCCGCCGGGCCCTGGCCAATGCCAACATCGAAGCCCCGCAGATGGGTTACCTC
GAAGCTCACGGTACCGGAACCTCGTTGGGCGATCCGATCGAGATGCGCGCGGTGGCGACC
GTGCTGTGCGAGGGCAGGAGCCAGGAGCAGAAGCTCATCGTGGGCTCGGTGAAGACGAAC
TTCGGGCACTTGGAGGCGGCGGCTGGGATCGCCGGTCTCATCAAGGTGGCGCTCTCGCTT
CATCACCAGGAGATCCCAGCGCACCTGCACCTCAAGAAGCCCAATCCGCTCATCCCTTGG
GAAACGCTGCCGGTGACGATCCCGACCCAGCGGATCTCCTGGCCCGTGGCGGACGGACAG
CGGCGCATCGCGGGCGTGAGTTCCTTCGGCATGAGCGGGACGAACTCGCATGTCATCCTT
GAGGAAGCTCCGCCCCAAGAGCCGGTGGCGCCCTCGGCTCAGGTGGAACGCCCCTGTCAT
CTCCTGGGCTTGTCGGCCAAGGGGGATGAGGCGCTCAAGGCGCTCGCGGTGCGCTATGAG
CGCCTTCTGGCGGAGCAGCCCGAGCTGTCCCTTCCGGACCTTTGCCATGGAGCCAATACT
GGCCGTACCCACTTTTCTCACCGATTGGCCGTCGTGGCCGAGTCTCAAGCTCAGCTCCGC
GAGCAACTCGCGGCCTTCATCGGTGGGCAGAAGGGGCAGGGGCTCGTGGCTCGCTCGGTG
CCGTCTGGCCGCGAGCCAGAACTCGTGTTCCTGTTCACGGGGCAGGGTTCCCAGTACGCC
GGGATGGGGCGGCAGCTCTACGAGACCCAGCCCGTTTTTCGGCAGACCCTGGATCAGTGT
GATGCCCTTCTGCAGCCCCATTTGGGGCGGTCGCTCTTGTCGGTGCTGTACCCGGAGCCG
GGCTCCAGGACTCCCCTCGATGAGACGGCCTTCACACAGCCGGCGCTGTTCGCGATTGAG
TACGCCCTTGCCATGCTCTGGCAGTCCTGGGGGATTCAGCCGACGGCCGTGATGGGGCAC
AGTGTTGGCGAGTACGTCGCCGCGTGTGTGGCTGGGGTTTTCTCGCTCGAAGATGGATTG
AGGCTCATCGCCGAGCGGGGACGGCTGATGCAGGCGCTGCCTCCCGATGGAGACATGGCC
GCTGTCTTCGCGGAGGAAGCACGGGTTGTTGAGGCCATCGCCCCGTTCTCGTCCCAGCTC
TCGATCGCCGCCGTGAACGGACCGACCGAGACGGTCATTTCCGGTGAGAAGGGCGCCCTG
GCGGCCGTGCTCGAGCGGCTGTCGGCTCAAGGCATCCAGGCGCGTCGGCTGAATGTCTCG
CACGCGTTCCACTCGCCCTTGATGCAGCCCATCGTGGACACGTTCGCGGGCGTCGTGGCC
AGCGTCACGTTCCATCCCCCCCAGTTCGAGCTTATCTCCAACGTCACCGGCCGCCCCGCG
GACCCGCAGCTCTTGAGCAGTTCAGAGTACTGGTGTCGTCATCTGCTCGCGCCAGTGCGT
TTTTGGGACAGCTTGCAATCGCTCCATCAGAGAGGGTCTCGGCTGTTCCTGGAGATTGGT
CCCGGCGCGACGCTGGCGAGCATGGGGCGGCGTGGCTTCTCTCAGGATGGCTCATGCCTC
TGGTTGTCTTCGCTCCAGAAGGATCGGGGGGACTGGACGCACCTGCTTCGGGCCTTGGGG
GAGTTGTACGCGTCTGGGCTCAAGGTGGACTGGCAGGCCTTCGATCAGGGCTACACGCGC
CACCACGTCACGTTGCCGACCTATCCCTTTCAGCGGGAGCGGCACTGGTTCAAGCTGAGC
CGTTCGTCGGCGATTCAGCCCGTGGCCGCGGTGGGTGCCCGAGATCTGGGGCCATCGCCA
GAGTCCGGGGAGGCGGAGCTTCCGGGCGATTGGCTCTATGAGCTGGAGTGGAAGCCATGG
GTTGCCTCGGTGCCCGTGCCGGAGCGTGCCAACTCGCCGCGCCAGTGGTTGATCTTCGCG
GATCGACATGGTCTGGGCGCAGCGCTGGCCGAGCGCATCGAGCAGCGGGGTGAGCGCTGT
GTCCTGGTGTCGCCTGCCCAGGCGGGTTCCGGGGGAGAGGGGACATCTGGGTCGGCCACC
TCCCGGCGAATGTCCGTCGACCCCCAGAATTCCGCGGACTACCGGCGGGTGATTCAAGAG
GCCTTCGCCGAGGGCTCCGAGCCTGCTGCTGTCGTCCACTTGTGGGGACTCGACGCAGAG
TCCGTGGAAGGGAAGGACAGCGCCGCGCTGGAAGAGGGGCAACACCTCGGGCAGAACAGC
GTGCTGATCCTCCTCCAGGCGCTGAGCGCTGTTGGAAGGGGAACGCCTCGGTTGTGGGCA
GTGACGCGTGGCGCGGCCCTCGTGGGCTCGGGGAAGCCCTCCCTGGTCCAGGCGCCGATC
TGGGGGCTTGGACGGGTGCTGGCCATCGAGCACCCGTCGTTGTGGGGCGGGCTCGTGGAT
TTGGATCCGGCCGCAGGTGCCACCGCGGGCGATGTCACCGCGCTCCTGGGCGAGTTCGAA
GCCCCGGAGGGAGAGGATCAGGTGGCCTGGCGCGGCGGCCAGCGGCTCGTGCCTCGCTTG
CGCCCCCAGCGCCTCCCCGAGCAGCAGGGGCGGGCGCCTCGCCTGAAGGCCGAGGCCACG
TACCTCGTGTCCGGTGCTCTTTCCGGTTCTCTGCTCGAGGTGTCGCGCTGGATGGTGGAG
CGTGGCGCGCGTCACCTGGTGCTGGCTGGGTTGGAGCAGTCCGAGGTCGGTGCACTCTCC
GAGGCGCTGTCGGCGCTCGAATCCCGGGGCGCCCACCTCCAGTTCCTCTCGCGAGACGAA
ATGCTCCAGTCTCCCGAGGCGCTCACCGGGTTGTTCTCATCGCTGCGTGAGTCGAACCGC
CCCCTTCGAGGCGTTTTGCACGCGGGAGGGGCGTGGACTCCTCGGGCCAGCCGCGATCTC
GGACCCGGGGAACTTCAGTCTGCCCTTCGCTCGGAAGTGGTTCTGCCTTGGGCTCTGCAC
GAGCAGGTCGCGGGCGAGGAACTCGAGTTCTTCATTCTGTTCTCGTCGGTCGCCTCGGTT
TGGGGCTCGGGTGGGCTGTCACACCATGCGGCAGCCCATCACGTGCTTGATGCGCTCGCG
CACCAGCGGCGTGCCTTGGGGCTGCCCGCCCTCGTGGTGAACTTCGGCCAGTGGGCTCAG
GTGGGTGTTCTTCCGGAAGAGGCGTACCGGATGTCGGCCCGCAGCGGGGTGGATGCCTTG
CCGCCCGCCACCGCCCTCGCCGTTTTGGAGCCCTTGCTTGAGGCAGGGGGGACGCAGCGG
ACGATCGCGAGCGTGCGCTGGAATGTCTTCAAGCCCATCCTCGAGATGGGGCGTGCCCGG
CCGATGCTCGCGGACATCGATGCGCGCGACCCCCAGCGAGGGGACGTGGTGGATGATGCC
GTGGAGCGTGCCCGGAAGTTGAAGGAAGCGCTCGGAGAGGCCCTCCCGAACGAGCGACAC
GAGGTGCTTCAAGCCTACCTCCAGGGTGATGTGGCCTCGGTGCTCGGTTACGAAAACCCG
GGTGATATTGAACCCACGGCTGGGTTCTTCGATCTCGGGATGGACTCCATCATGGCGATG
GATCTCAAGACCCGTTTGGAGAGGGGAATGGAGCGCACATTCCCTTCCACGATGGCCTTC
GAGCATCCAACGATCGATGCACTTGCGCGTTACCTGAGCAAGGAAGTATTCGCCACTCTG
TTCGAAGAAGCTCCCCGCGCGACCACGCCGGAGCCTGTATCGAATGACGACGACGCTCGA
TGGGATGCTCTCGATGAGCTGTCGGAAGACCAGGTGGCCTCGCTCCTCGCGGAGCGGTTG
AACGCGATCGAGTAG
[8] KS37..411
[8] AT569..888
[8] malonyl-CoA761..765
[8] kr1199..1380
[8] ACP1483..1553
[8] KS109..1233
[8] AT1705..2664
[8] malonyl-CoA2281..2295
[8] kr3595..4140
[8] ACP4447..4659

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [562-693]  4.69999999999992e-89 G3DSA:3.40.366.10 [761-878]  4.69999999999992e-89 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [1483-1553]  PS50075
PS50075   ACP_DOMAIN
 [1487-1552]  5.8e-14 PF00550
PF00550   PP-binding
 [1482-1556]  1e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1476-1556]  2.49999811956465e-20 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1199-1380]  4.2e-48 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [37-286]  6.10000000000004e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [294-411]  6.29999999999998e-40 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [569-888]  4.49999999999996e-77 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [567-883]  5.39997012872478e-76 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [695-760]  3.0999994589937e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-297]  1.29999999999998e-96 G3DSA:3.40.47.10 [298-467]  8.50000000000004e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [29-410]  2.1000026783403e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1198-1385]  5.40000000000001e-16 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [199-215]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [571-869]  4.70006519200354e-129 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1484-1556]  1.50000306971104e-25 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [39-465]  SM00825
SM00825   PKS_KS
SignalP
 [1-36]  0.104 Signal
Eukaryota   
TMHMM No significant hit