close all open/close all

CDS information : Stigm_00170


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction59,223 / 63,002 / + [in whole cluster]
59,223 / 63,002 / + [in contig]
Location59223..63002 [in whole cluster]
59223..63002 [in contig]
TypeCDS
Length3,780 bp (1,259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)StiJ protein
Gene
Gene (GenBank)stiJ
EC number
Keyword
  • iterative
Note
Note (GenBank)
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)

close this sectionPKS/NRPS Module

10 malonyl-CoA
KS35..405
AT565..882
ACP967..1036

close this sectionSequence

selected fasta
>polyketide synthase [StiJ protein]
MSVKTKDNQDLLKRALVTIDKLQAKVDALERAKSEPIAVVGIGCRLPGGANDPESFFQML
REGRDATSDMPAERWDADAYYDPDPDAPLKMYTRRGGFLDQVDQFDPQFFGISPREAVSM
DPAQRIFLEVCWEALERAGQAPDKLGGTRTGVFVGAGTEEYAHVIEAAGYCDTHTATGNI
PGFVSGRISYLLGLTGPSVTLNTTCSSSLAAVHTAMQSLRAKECDMALAGGVNLILRVSP
FVALCKIRMLSRDGRCKTFDASADGYGRSEGCGVVVLKRLSDAQRSGDHILALLRGSSMQ
QNGSTTSGITVTSVPAQQSLIREALANTGVEPSQVSYVEAHGTGTTLGDPIEVQAIASVV
SEGRSADQPLMIGSVKANLGHSELAAGVTGLIKVVLSMHHEELPPYPSHLTQRNPAIAWN
DLKVMLPTEITPWPRGNGRRFAGVNSLGGNGLNVHVVVEEAPLPSPVPVGLERPRHMFAL
SATRETALSALAGRYARHLAKHPSLSLADVCFTAGAGRSHFKHRAAFQATSVEQLRTQLE
ALAAGSGVRTRSAALRRSGRPKIAFLFTGQGSQYVGMGRALFETQPVFRRAILECEEVLR
PILPKPLLSVLYPEVGQESPIDETEYTQPALFAVEYALATLWRSWGIEPSIVMGHSVGEY
VAACVAGVFSLEEGLRLIAERGRLMSTLPRDGDMVAVFATEARVTAALAPVANDVSIAAV
NGPEEIVISGARDGVNKVVEQLTAEGIKTRRLTVSHAFHSPLMSPIRSAFTEAASRVNYA
APRVRVISNITGRAAKGSELSQPSYWVEHVQAPVRFADGLRALHEHGCDAFLEVGPQATL
LGLGKRCLPDAVQPWLPSLRKGHDEWESLLGSLGALYESGVDVDWAGFDRDYPRRRLPLP
TYAFQRERYWVEPQEGAQVHVETRSFASARPLEEVPATVERSVEEEEPGLHLEALRLASP
EVRNEEVSAWLRQLVSRVFKLAEADLDSQEPILNLGLDSLMAVDMKERIKRGFDIDLSLA
ELLEGPSIAALSERLGQMLEQATPRVLAVQAPAPSPTPVVRPRETAPSTGPKKAQGKRPV
INHQCVGTWKLVSFESKTPDGRNFIDFVSKKTMRLALSALGSVLPSAMPMNFQPNAPVFY
PFGPSPIGHLIYTAEGHYALDMGSQGRRGFGSEELATASPMAQRSALMTYISSSGKFTAE
GDQVIHKVEAHLYPDEVGRDHAFTMEFDKNGRMIALKPTAPSPLFGGKSVLTYATWERV
selected fasta
>polyketide synthase [StiJ protein]
ATGTCGGTAAAGACCAAAGACAATCAAGACCTGTTGAAGCGTGCGCTCGTCACCATCGAC
AAGCTCCAAGCGAAAGTCGACGCGTTGGAGCGAGCGAAGTCGGAGCCGATCGCCGTGGTG
GGCATTGGGTGTCGGCTTCCCGGTGGGGCCAATGACCCCGAGTCCTTCTTCCAGATGCTG
CGGGAGGGGAGGGATGCCACGAGCGATATGCCGGCCGAGCGGTGGGACGCGGACGCCTAT
TACGATCCCGACCCCGACGCCCCGCTCAAGATGTACACCCGGCGAGGCGGCTTCCTCGAT
CAGGTCGATCAGTTCGATCCTCAGTTCTTCGGCATCTCCCCGCGCGAAGCGGTGAGCATG
GATCCGGCGCAGCGGATCTTCCTGGAGGTGTGCTGGGAAGCGCTCGAGCGCGCGGGACAG
GCTCCGGACAAGCTGGGCGGTACGCGCACCGGCGTATTCGTGGGCGCGGGGACCGAGGAG
TACGCGCATGTCATCGAGGCCGCGGGGTACTGCGACACGCACACGGCCACGGGCAACATC
CCGGGCTTTGTGTCGGGGCGAATCTCCTACCTGCTGGGGTTGACGGGACCGAGCGTGACG
CTCAACACCACCTGCTCGTCCTCGCTTGCGGCGGTGCACACGGCCATGCAGAGCCTTCGC
GCGAAGGAATGCGACATGGCGCTCGCGGGAGGGGTTAACCTCATCCTGCGCGTGTCCCCC
TTCGTCGCGCTTTGCAAGATCCGGATGCTCTCACGCGACGGGCGGTGCAAGACGTTCGAC
GCCTCCGCGGATGGCTACGGCCGGTCCGAGGGCTGTGGGGTCGTGGTGCTCAAGCGCTTG
TCCGATGCCCAGCGCAGTGGGGACCACATCCTGGCGCTGCTCCGCGGCTCGTCCATGCAG
CAGAACGGCAGCACGACGAGCGGCATCACGGTCACGAGCGTCCCGGCACAGCAGTCGCTC
ATTCGCGAGGCGCTGGCCAACACCGGCGTGGAGCCCTCCCAGGTGAGTTATGTGGAGGCC
CATGGCACGGGGACCACGTTGGGAGACCCCATCGAGGTGCAGGCCATCGCGTCAGTGGTG
TCCGAGGGGCGGTCCGCGGATCAGCCGCTGATGATTGGTTCCGTGAAGGCCAACCTGGGG
CACTCGGAGCTCGCGGCGGGGGTGACGGGTCTCATCAAGGTCGTGCTGTCGATGCACCAT
GAAGAGCTGCCCCCCTATCCGTCGCACCTGACGCAGCGCAACCCCGCCATCGCCTGGAAC
GATCTGAAGGTCATGCTCCCGACGGAGATCACCCCTTGGCCCAGAGGCAATGGCCGTCGT
TTCGCAGGTGTCAACTCGCTCGGTGGCAATGGTCTCAACGTTCACGTGGTGGTGGAGGAG
GCGCCGCTGCCCTCTCCCGTGCCCGTGGGGCTGGAGCGTCCCCGTCACATGTTCGCTTTG
TCCGCGACACGGGAGACGGCGCTCTCCGCGCTCGCGGGGCGCTATGCGCGCCACCTCGCG
AAGCACCCCTCGCTGTCCCTGGCGGACGTCTGCTTCACGGCCGGCGCGGGGCGGTCGCAT
TTCAAGCACCGTGCGGCGTTCCAGGCCACGTCGGTCGAGCAGTTGCGCACGCAACTGGAA
GCCCTCGCGGCGGGTTCGGGGGTGCGCACCCGCTCGGCGGCGCTCCGTCGGTCAGGGCGT
CCGAAGATCGCGTTCCTGTTCACCGGCCAGGGCTCGCAGTACGTGGGCATGGGGCGGGCC
CTTTTCGAGACGCAGCCCGTCTTCCGTCGGGCGATCCTTGAGTGCGAGGAGGTGCTTCGC
CCCATCCTGCCGAAGCCGCTGCTCTCGGTGCTCTACCCGGAGGTGGGCCAGGAGTCGCCC
ATTGACGAGACCGAGTACACGCAGCCCGCCCTGTTCGCGGTCGAGTATGCCCTGGCCACG
CTGTGGCGCTCCTGGGGCATCGAGCCCTCGATCGTCATGGGACACAGCGTGGGCGAGTAC
GTCGCCGCGTGCGTGGCGGGCGTGTTCAGCCTCGAGGAGGGTTTGCGGCTCATCGCCGAG
CGCGGTCGCCTCATGTCGACCCTGCCGCGCGATGGGGACATGGTTGCCGTTTTCGCCACC
GAGGCCCGTGTGACGGCGGCCTTGGCGCCCGTCGCGAACGACGTTTCCATCGCGGCCGTC
AATGGCCCGGAGGAGATCGTCATCTCCGGCGCGCGTGATGGGGTGAACAAGGTGGTCGAG
CAACTCACTGCCGAGGGGATCAAGACGCGGCGGTTGACTGTCTCGCACGCCTTCCACTCG
CCCCTGATGAGCCCCATTCGGTCCGCGTTCACAGAGGCTGCGTCGCGGGTGAACTATGCG
GCGCCTCGCGTGCGCGTGATCTCGAACATCACCGGTCGGGCCGCCAAGGGCTCGGAACTC
TCTCAGCCGTCGTACTGGGTCGAGCATGTCCAGGCGCCGGTGCGTTTCGCCGACGGGCTG
CGCGCGCTCCACGAGCACGGGTGTGATGCCTTCCTGGAGGTGGGTCCTCAGGCTACGTTG
CTGGGGCTGGGCAAGCGGTGCCTGCCGGACGCGGTCCAGCCGTGGCTGCCGTCCCTGCGC
AAGGGGCATGACGAGTGGGAGTCCCTGCTCGGGAGCCTGGGTGCCCTCTACGAGAGCGGT
GTGGATGTCGATTGGGCGGGGTTCGACCGGGACTACCCGAGGAGGCGCCTGCCGCTTCCC
ACCTACGCCTTCCAGCGCGAGCGCTACTGGGTCGAGCCCCAGGAGGGCGCCCAGGTCCAC
GTCGAGACCCGGTCTTTCGCGTCGGCACGCCCCCTCGAGGAGGTGCCTGCCACGGTCGAG
CGGAGCGTCGAGGAGGAGGAGCCCGGGCTCCATCTCGAGGCGCTTCGCCTGGCCAGCCCG
GAAGTGCGGAACGAAGAGGTCTCCGCGTGGCTTCGCCAGCTTGTGAGCCGCGTCTTCAAG
CTCGCGGAAGCCGATCTCGATTCCCAGGAGCCCATTCTCAACCTCGGGCTCGATTCGCTC
ATGGCCGTCGACATGAAAGAGCGGATCAAACGCGGCTTCGATATCGATCTGTCGTTGGCC
GAGCTGCTCGAGGGGCCGAGCATCGCCGCGCTTTCCGAGCGGCTCGGTCAGATGCTGGAG
CAGGCCACGCCCCGGGTGCTTGCTGTCCAGGCTCCTGCCCCTTCACCCACCCCTGTCGTT
CGCCCTCGGGAGACCGCTCCCAGCACCGGTCCGAAGAAGGCCCAAGGAAAACGCCCTGTG
ATCAACCATCAATGTGTCGGAACCTGGAAGCTGGTCTCGTTCGAGTCGAAGACTCCGGAT
GGGCGCAACTTCATCGACTTCGTCTCGAAGAAGACGATGCGGCTCGCGCTCTCGGCGCTT
GGGTCGGTGCTTCCCTCGGCGATGCCGATGAACTTCCAGCCCAACGCGCCCGTCTTCTAC
CCCTTCGGGCCTTCTCCCATCGGCCACCTCATCTACACCGCGGAGGGGCATTACGCCCTG
GACATGGGGAGCCAGGGGCGCCGGGGCTTCGGCTCGGAGGAGCTCGCGACGGCCAGCCCC
ATGGCGCAGCGGAGCGCGCTCATGACTTACATCTCCTCGTCCGGCAAGTTCACCGCCGAG
GGCGACCAGGTCATTCACAAGGTGGAGGCGCATCTCTATCCCGATGAGGTGGGCCGGGAT
CACGCCTTCACGATGGAGTTCGACAAGAACGGTCGGATGATCGCGCTGAAGCCCACCGCC
CCCTCGCCGCTCTTCGGCGGCAAGTCCGTCCTCACGTATGCCACCTGGGAACGCGTCTGA
[10] KS35..405
[10] AT565..882
[10] malonyl-CoA756..760
[10] ACP967..1036
[10] KS103..1215
[10] AT1693..2646
[10] malonyl-CoA2266..2280
[10] ACP2899..3108

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [558-688]  1.79999999999997e-85 G3DSA:3.40.366.10 [756-871]  1.79999999999997e-85 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [967-1036]  PS50075
PS50075   ACP_DOMAIN
 [960-1060]  3.00000067992871e-18 SSF47336
SSF47336   ACP_like
 [970-1035]  3.60000000000001e-12 PF00550
PF00550   PP-binding
 [961-1040]  2.80000000000001e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-283]  9.39999999999981e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-405]  9.40000000000003e-39 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [565-882]  5.40000000000002e-69 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [562-866]  1.39999277195148e-73 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [690-755]  1e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-295]  3.10000000000005e-98 G3DSA:3.40.47.10 [296-462]  6.19999999999994e-53 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-461]  6.10002656149838e-101 SSF53901
SSF53901   Thiolase-like
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [566-863]  6.40004254961849e-125 SM00827
SM00827   PKS_AT
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825
SM00825   PKS_KS
IPR024311 Lipocalin-like domain (Domain)
 [1086-1259]  5.30000000000001e-56 PF13924
PF13924   Lipocalin_5
SignalP No significant hit
TMHMM No significant hit