close all open/close all

CDS information : Stigm_00180


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction63,070 / 63,840 / + [in whole cluster]
63,070 / 63,840 / + [in contig]
Location63070..63840 [in whole cluster]
63070..63840 [in contig]
TypeCDS
Length771 bp (256 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative methyltransferase
Product (GenBank)methyl transferase
Gene
Gene (GenBank)stiK
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)
Family/Domain
FD
IPR010233, IPR013216

close this sectionSequence

selected fasta
>putative methyltransferase [methyl transferase]
MPVNNGMYDEMNWWNDDSSVSLLSTSINPCRIAYFHNLLTNRIGLDPTKVRVLDVGCGGG
LLAEEFSKKGWKVTGVDQSAPSIELAKAHSAKVGLNIDYHVSKAQKLPFEDETFDIVYCC
DVLEHIPTYPAAVAESARVLKKGGVYLYETINRTFMSKMIAIKMLQEWSWTRVIPDDVHD
WKMFIRPEELHNAMHAAKIQNVETAGMTVDNPVGFIRAILRHRRGHSSLGDVGRVAPAVV
SKDLSMGYMGFGVKTA
selected fasta
>putative methyltransferase [methyl transferase]
ATGCCTGTCAATAATGGGATGTATGATGAGATGAACTGGTGGAATGACGACTCGTCCGTC
AGCCTTCTGTCGACGTCGATCAACCCGTGCCGCATTGCCTATTTCCACAACCTGCTCACC
AACCGGATTGGGCTCGATCCCACGAAGGTGCGCGTGCTCGACGTCGGCTGTGGCGGCGGT
CTGCTGGCCGAGGAGTTTTCCAAGAAGGGCTGGAAAGTGACGGGCGTCGATCAGTCCGCC
CCGTCCATCGAGCTGGCCAAGGCCCACTCCGCGAAGGTGGGGCTCAACATCGACTACCAC
GTCTCCAAGGCTCAGAAGCTCCCGTTCGAGGACGAGACCTTCGACATCGTCTATTGCTGT
GATGTGCTCGAGCACATTCCCACCTATCCCGCCGCCGTCGCGGAGAGCGCTCGGGTGCTC
AAGAAGGGGGGCGTCTATCTCTACGAGACCATCAACCGGACGTTCATGAGCAAGATGATC
GCCATCAAGATGCTTCAGGAGTGGTCCTGGACGCGGGTGATCCCCGACGATGTGCACGAC
TGGAAGATGTTCATCCGTCCCGAGGAGCTTCACAACGCGATGCATGCAGCGAAGATCCAG
AACGTCGAGACGGCGGGCATGACGGTCGACAATCCCGTGGGCTTCATCCGGGCGATCCTC
CGCCACCGCCGGGGCCACTCCTCGCTCGGCGATGTGGGACGCGTCGCGCCCGCGGTGGTC
TCGAAGGATCTGTCGATGGGGTACATGGGGTTCGGGGTCAAGACCGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010233 Ubiquinone biosynthesis O-methyltransferase (Family)
 [12-208]  4.30000000000003e-48 TIGR01983
TIGR01983   UbiG
IPR013216 Methyltransferase type 11 (Domain)
 [53-146]  4.29999999999999e-25 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit