close all open/close all

CDS information : Stigm_00190


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction63,899 / 65,470 / + [in whole cluster]
63,899 / 65,470 / + [in contig]
Location63899..65470 [in whole cluster]
63899..65470 [in contig]
TypeCDS
Length1,572 bp (523 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Producthydroxylase
Product (GenBank)cytochrome P450 dependent monooxygenase
Gene
Gene (GenBank)stiL
EC number
Keyword
  • C-8
Note
Note (GenBank)
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)
Related Reference
ACC
P77397
PmId
[9603882] Characterization of the hca cluster encoding the dioxygenolytic pathway for initial catabolism of 3-phenylpropionic acid in Escherichia coli K-12. (J Bacteriol. , 1998)

close this sectionSequence

selected fasta
>hydroxylase [cytochrome P450 dependent monooxygenase]
MDVAIVGGGPVGLMAANLLGSYGVGVLVLERESSPHTYPRAVALYDDALRTFQAVGLVEK
QASEMMMDLEMQIVSGTGQLLIGVNPAVASMPFGHPSGGAMLQPLLEDNLRKGLGRFKDV
ELRLGHRVDGVVQDSEGVQLRVTSANGESYTVRARYALGCDGGKSSLREACGIELAGSTI
DQPWLVIDTRKPTQSPPKARIVADAVRPMVYIPLPDRYERWETRLMRGETPEHFSTEQSV
RDILAPWMKSEPYEIVRHRVYIHHYRLAERYRDRRIFLLGDAAHLVPPFGAQGLSSGIRD
AVNLAWKVAMAVKGLVGSEVLNSYQAERRMQMRETMLGVRMMSMVVSPNKWTAPLRDGFF
GLLAAIPPVRKALHEVDGRFPSRFRSGFFLRGGGAGDMIIQPRVRTQKGGNVLLDEVLGT
GFAVVGMNREPAHVMSSASKRFWEGLGARFVRVVSGNTIVGEDSGVEGGSVVAADESGAL
TKWFTASGGDMAIVRPDRYVAALFQASRVDSVTSDLQRMLRAS
selected fasta
>hydroxylase [cytochrome P450 dependent monooxygenase]
GTGGATGTAGCCATCGTCGGCGGAGGCCCCGTGGGGCTCATGGCCGCCAATCTCCTGGGC
TCTTACGGTGTCGGGGTGCTGGTGCTCGAGCGCGAGTCATCCCCGCACACCTATCCTCGC
GCGGTCGCGCTGTACGACGATGCACTGCGCACCTTCCAGGCCGTGGGGCTCGTCGAGAAG
CAGGCCTCCGAGATGATGATGGATCTCGAGATGCAGATCGTGTCCGGCACCGGGCAGCTT
CTCATCGGCGTCAATCCCGCCGTGGCCTCCATGCCCTTCGGCCACCCTTCGGGTGGCGCG
ATGCTTCAGCCCTTGCTGGAGGACAACCTCCGCAAGGGGTTGGGCCGGTTCAAGGACGTC
GAACTGCGTCTGGGCCATCGCGTGGACGGAGTCGTTCAGGATTCCGAGGGGGTCCAACTC
CGCGTCACCAGCGCTAACGGAGAGAGCTACACCGTTCGGGCTCGTTATGCCCTGGGGTGT
GATGGCGGCAAGAGCTCGCTGCGCGAGGCGTGTGGCATCGAGCTCGCAGGATCGACGATC
GACCAGCCCTGGCTCGTCATCGATACGCGCAAGCCGACGCAATCGCCCCCCAAGGCACGG
ATTGTCGCCGACGCCGTTCGGCCGATGGTCTACATCCCCCTGCCGGATCGGTATGAGCGC
TGGGAGACGCGGCTGATGCGTGGGGAGACCCCAGAGCACTTCTCCACTGAGCAGAGCGTG
CGCGACATCCTGGCTCCGTGGATGAAGTCCGAGCCGTACGAGATCGTCCGGCACCGTGTG
TACATCCACCACTACCGGCTCGCGGAGCGCTACCGGGATCGGCGCATCTTCCTGCTCGGC
GATGCAGCGCATCTGGTTCCTCCCTTCGGGGCCCAGGGCTTGTCCTCTGGAATTCGTGAC
GCGGTGAACCTTGCCTGGAAGGTCGCCATGGCCGTGAAGGGATTGGTGGGCTCCGAGGTG
TTGAACAGCTACCAGGCGGAGCGCCGCATGCAGATGCGCGAGACGATGCTCGGCGTCCGG
ATGATGAGCATGGTGGTCTCGCCCAACAAGTGGACGGCTCCCCTGAGGGATGGCTTCTTC
GGGCTTCTGGCGGCCATTCCCCCTGTCCGCAAGGCCCTCCATGAGGTGGATGGACGGTTC
CCCAGCCGGTTCCGCAGTGGTTTCTTTCTTCGGGGCGGCGGCGCGGGCGACATGATCATC
CAGCCGCGCGTCAGGACGCAGAAGGGCGGCAATGTGCTGCTCGATGAGGTGTTGGGCACC
GGCTTCGCGGTCGTTGGGATGAATCGAGAGCCCGCCCACGTCATGAGCTCGGCGTCGAAG
CGATTCTGGGAAGGGCTCGGCGCCCGCTTCGTCCGGGTGGTGTCCGGAAACACCATCGTT
GGGGAGGACTCGGGCGTGGAGGGCGGGAGCGTCGTGGCCGCGGACGAGAGTGGCGCGCTG
ACGAAGTGGTTCACTGCCAGTGGCGGGGACATGGCGATTGTCCGGCCGGACCGGTACGTG
GCCGCGCTCTTCCAGGCGTCCCGCGTTGATTCGGTGACTTCGGATCTCCAGCGGATGCTG
CGCGCGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [2-332]  5.19999999999996e-63 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [2-24]  4.79998722798115e-35 PR00420 [153-168]  4.79998722798115e-35 PR00420 [273-288]  4.79998722798115e-35 PR00420 [288-304]  4.79998722798115e-35 PR00420 [306-324]  4.79998722798115e-35 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-37]  0.095 Signal
Bacteria, Gram-negative   
TMHMM No significant hit