close all open/close all
Stigm_00190 Stigm_00190   last last

CDS information : Stigm_00200


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction65,537 / 66,808 / + [in whole cluster]
65,537 / 66,808 / + [in contig]
Location65537..66808 [in whole cluster]
65537..66808 [in contig]
TypeCDS
Length1,272 bp (423 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative tRNA nucleotidyltransferase
putative CCA-adding enzyme
Product (GenBank)polynucleotide adenyltransferase
Gene
Gene (GenBank)
EC number2.7.7.72
Keyword
Note
Note (GenBank)
  • ORF9
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)
Related Reference
ACC
Q7SIB1
PmId
[12526808] Crystal structures of the Bacillus stearothermophilus CCA-adding enzyme and its complexes with ATP or CTP. (Cell. , 2002)
ACC
P42977
PmId
[9829937] The Bacillus subtilis nucleotidyltransferase is a tRNA CCA-adding enzyme. (J Bacteriol. , 1998)

close this sectionSequence

selected fasta
>putative tRNA nucleotidyltransferase [polynucleotide adenyltransferase]
MTFESLHRADIPRPILDVLQRLRELGFAVFLVGGCVRDILRGVAPKDFDVASSALPQEVQ
GAFKKVIPTGIQHGTVTVVIGGNHVEVTTFRSEGDYLDGRRPSSVTFERDITQDLSRRDF
TINAMAYDPLGRELVDPFGGMTDLHARLIRCVRSPIERFSEDGLRPLRAVRFAAVLGFTL
DPATRDAIPPTLPVFRKVALERVREEFVKLLLSPRAELGLSLLVETGLLEAFLPELSSAG
DEAARMARAAVQGAPAEVEIRLAALLADLVRGSQARDIALRLKFPTKVADTVGLLVEHAA
LEERTEQAEPALRRLLAQVGPALLEPLLAVARSRVEARQPERLPSVLRLQERLRTLAAAK
PPLTSKELALTGKDIMAALGIGPSPQVGEATRFLLEAVLDDPALNESERLKDLLRIWQAG
KGV
selected fasta
>putative tRNA nucleotidyltransferase [polynucleotide adenyltransferase]
ATGACGTTCGAGTCACTCCACCGCGCCGATATTCCGCGTCCCATTCTGGATGTTCTCCAG
CGGCTGCGGGAGCTGGGGTTCGCCGTCTTTCTGGTGGGCGGCTGCGTCCGGGACATTCTT
CGAGGCGTTGCGCCCAAGGATTTCGACGTGGCCTCCAGCGCGCTCCCCCAGGAGGTTCAG
GGTGCGTTCAAGAAGGTCATCCCCACCGGCATTCAGCATGGCACCGTGACGGTCGTCATC
GGGGGAAACCATGTGGAGGTGACCACCTTCCGAAGCGAGGGGGACTACCTTGATGGGCGC
CGCCCCAGTTCCGTCACGTTCGAGCGTGACATCACCCAGGATCTCTCGCGCCGGGATTTC
ACCATCAACGCCATGGCCTATGATCCCCTGGGTCGGGAGCTGGTGGATCCCTTTGGTGGC
ATGACGGATCTCCACGCTCGCCTCATCCGGTGTGTTCGCAGCCCCATCGAGCGCTTTTCC
GAGGATGGGCTTCGTCCCCTGCGGGCCGTGCGCTTCGCGGCGGTGCTCGGCTTCACGCTC
GATCCGGCCACGCGGGACGCCATTCCCCCCACGCTTCCTGTTTTCAGGAAGGTGGCGCTG
GAACGGGTTCGGGAGGAGTTCGTCAAGTTGCTGCTGTCTCCCCGGGCCGAGTTGGGTCTC
TCGCTGCTCGTGGAGACCGGTCTTCTGGAAGCCTTTCTTCCTGAGCTTTCGAGCGCGGGG
GACGAGGCCGCTCGGATGGCCCGCGCCGCCGTCCAGGGCGCCCCGGCGGAAGTGGAGATC
CGGCTGGCGGCCCTGCTGGCGGATCTCGTTCGCGGTTCTCAGGCCCGTGACATCGCGCTT
CGGCTCAAGTTCCCCACCAAGGTGGCCGACACGGTCGGTCTGCTGGTGGAGCACGCCGCC
CTGGAGGAGCGCACCGAGCAGGCCGAGCCCGCGCTCCGGAGGCTGCTTGCCCAGGTAGGG
CCTGCGTTGCTGGAGCCCTTGCTGGCGGTCGCGCGGTCGCGCGTGGAGGCCCGCCAACCC
GAGCGTCTCCCCTCGGTTCTGAGGCTCCAGGAGCGGCTGCGCACCCTGGCTGCCGCGAAG
CCGCCGCTGACTTCGAAGGAGCTCGCGCTCACGGGCAAGGACATCATGGCCGCGCTGGGA
ATCGGGCCTTCCCCCCAGGTGGGGGAGGCGACCCGATTCTTGCTGGAGGCTGTTCTCGAT
GACCCTGCCCTCAATGAATCCGAGCGGTTGAAGGACCTTCTGAGAATCTGGCAAGCAGGG
AAGGGTGTTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002646 Poly A polymerase, head domain (Domain)
 [29-150]  5.40000000000002e-35 PF01743
PF01743   PolyA_pol
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM No significant hit
Stigm_00190 Stigm_00190   last last