close all open/close all
first first   Stref_00020 Stref_00020

CDS information : Stref_00010


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction1,502 / 51 / - [in whole cluster]
1,502 / 51 / - [in contig]
Locationcomplement(51..1502) [in whole cluster]
complement(51..1502) [in contig]
TypeCDS
Length1,452 bp (483 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative inosine-5'-monophosphate dehydrogenase
Product (GenBank)putative inosine monophosphate dehydrogenase
Gene
Gene (GenBank)
EC number1.1.1.205
Keyword
Note
  • It is supposed that this ORF is not involved in steffimycin biosynthesis.
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q9RHG9
PmId
[10923792] Molecular cloning, overproduction and characterization of the Bacillus cereus IMP dehydrogenase. (Biosci Biotechnol Biochem. , 2000)

close this sectionSequence

selected fasta
>putative inosine-5'-monophosphate dehydrogenase [putative inosine monophosphate dehydrogenase]
MQHVRFLNDIQPGYDLTYDDVFMVPSRSSVGSRQAVDLSSPDGTGTTIPLVVANMTAIAG
RRMAETVARRGGLVVIPQDIPIDVVTEVVSWVKSRHLVLDTPIILSPHQTVADALALLPK
RAHNAGVVVDEDHKPVGVVTDSDLSGVDRFTQLAEVMSRDLLLIDADMDPGEAFDTLDHA
NRRYAPAVNEDGTLAGILTRKGALRATLYQPATDARGRLRIAAAVGINGDVAGKAKQLLD
AGVDALVIDTAHGHQESMIGALKLVRDLDPQVPIVAGNVVAAAGVRDLIEAGADIVKVGV
GPGAMCTTRMMTGVGRPQFSAVLECAAEAKKYGKHVWADGGVRHPRDVAMALAAGASNVM
IGSWFAGTYESPGDLQHDAQGRAYKESFGMASARAVRNRTSEESAYDRARKALFEEGIST
SRMFLDPDRPGVEDLIDSIIAGVRSSCTYAGAGSLEEFAEKAIVGIQSAAGYAEGKPLHA
SWS
selected fasta
>putative inosine-5'-monophosphate dehydrogenase [putative inosine monophosphate dehydrogenase]
GTGCAGCACGTGCGTTTCCTCAATGACATCCAGCCCGGGTACGACCTGACGTACGACGAC
GTCTTCATGGTGCCGAGCCGCTCCTCGGTGGGCTCACGGCAGGCTGTCGACCTCAGCTCC
CCGGACGGCACGGGCACCACCATCCCGCTCGTCGTCGCCAACATGACCGCCATCGCCGGG
CGCCGCATGGCCGAGACCGTGGCCCGTCGGGGTGGCCTCGTCGTCATACCGCAGGACATC
CCGATCGACGTGGTCACCGAGGTCGTCTCCTGGGTGAAGAGCCGTCATCTGGTCCTGGAC
ACCCCGATCATCCTGTCTCCGCACCAGACCGTCGCCGACGCGCTGGCCCTGCTGCCCAAG
CGGGCGCACAACGCGGGCGTCGTCGTCGACGAGGACCACAAGCCGGTCGGCGTGGTCACC
GACTCCGACCTGTCCGGCGTGGACCGCTTCACACAGCTCGCCGAGGTCATGTCCCGGGAC
CTGCTGCTGATCGACGCGGACATGGACCCGGGCGAGGCCTTCGACACCCTCGACCACGCC
AACCGCCGCTACGCCCCGGCGGTCAACGAGGACGGCACGCTCGCCGGCATCCTCACCCGC
AAGGGCGCCCTGCGCGCCACGCTCTACCAGCCGGCCACCGACGCCCGCGGCCGGCTCCGC
ATCGCCGCCGCCGTCGGTATCAACGGCGATGTCGCGGGCAAGGCCAAGCAGCTGCTCGAC
GCGGGTGTCGACGCGCTCGTCATCGACACGGCGCACGGCCACCAGGAGTCGATGATCGGC
GCCCTGAAGCTGGTGCGCGACCTCGACCCGCAGGTGCCGATCGTCGCGGGCAACGTCGTG
GCCGCCGCGGGTGTGCGCGACCTGATCGAGGCCGGCGCGGACATCGTCAAGGTCGGTGTC
GGACCCGGCGCCATGTGCACCACGCGCATGATGACCGGCGTCGGCCGCCCGCAGTTCTCC
GCCGTCCTGGAGTGCGCCGCCGAGGCGAAGAAGTACGGCAAGCACGTGTGGGCCGACGGC
GGCGTCCGCCACCCCCGCGACGTGGCCATGGCCCTCGCGGCCGGTGCGTCCAACGTCATG
ATCGGCTCCTGGTTCGCGGGCACCTACGAGTCCCCGGGCGACCTCCAGCACGACGCGCAG
GGGCGGGCCTACAAGGAGTCCTTCGGCATGGCGTCCGCGCGGGCCGTGCGCAACCGCACC
TCGGAGGAGTCGGCGTACGATCGGGCCCGCAAGGCGCTGTTCGAGGAGGGCATCTCCACC
TCCCGCATGTTCCTCGACCCCGACCGCCCCGGCGTCGAGGACCTGATCGACTCGATCATC
GCGGGTGTCCGCTCCTCCTGCACCTACGCCGGTGCCGGCTCCCTGGAGGAGTTCGCCGAG
AAGGCCATCGTCGGCATCCAGAGCGCCGCCGGCTACGCCGAGGGCAAGCCGCTGCACGCC
AGCTGGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000644 Cystathionine beta-synthase, core (Domain)
 [101-144]  1.9e-08 PF00571 [154-206]  2.2e-07 PF00571
PF00571   CBS
 [98-155]  PS51371 [157-215]  PS51371
PS51371   CBS
 [101-149]  0.000390000075897037 SM00116 [160-208]  0.00919999929601216 SM00116
SM00116   CBS
IPR001093 IMP dehydrogenase/GMP reductase (Domain)
 [15-471]  1.79999999999997e-112 PF00478
PF00478   IMPDH
IPR005991 IMP dehydrogenase-related 1 (Family)
 [5-480]  TIGR01303
TIGR01303   IMP_DH_rel_1
IPR013785 Aldolase-type TIM barrel (Domain)
 [12-479]  G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
IPR018529 Inosine-5'-monophosphate dehydrogenase-related (Family)
 [1-481]  PIRSF000130
PIRSF000130   IMPDH
SignalP No significant hit
TMHMM No significant hit
first first   Stref_00020 Stref_00020