close all open/close all

CDS information : Stref_00030


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction3,023 / 1,980 / - [in whole cluster]
3,023 / 1,980 / - [in contig]
Locationcomplement(1980..3023) [in whole cluster]
complement(1980..3023) [in contig]
TypeCDS
Length1,044 bp (347 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in steffimycin biosynthesis.
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
P39140
PmId
[8550462] Dra-nupC-pdp operon of Bacillus subtilis: nucleotide sequence, induction by deoxyribonucleosides, and transcriptional regulation by the deoR-encoded DeoR repressor protein. (J Bacteriol. , 1996)
[10074062] Identification and characterization of a DeoR-specific operator sequence essential for induction of dra-nupC-pdp operon expression in Bacillus subtilis. (J Bacteriol. , 1999)
[10714997] Purification and characterization of the DeoR repressor of Bacillus subtilis. (J Bacteriol. , 2000)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative transcriptional regulator]
MNSSEEIAVSGMSAGRSAMRMGPAELVQAAAMARRFYLEGKSKIQIAEEFGVSRFKVARV
LETALERDLVRIEIRVPAELDAERSDALRARYGLRHAVVVESPAEAEETPDPENLGEVAA
DLLGELVNEGDVLGLAWGRSTIHMAAALDRLPPCTVVQLTGVYDAGTAERGSVEAVRRAA
QVSGGDAHPIYAPMLLPDAATASALRNQTGIARAFEHFDKVTVACVSIGSWEPGISTVHD
MLSDEERAHYASLGVAAEMSAHLFDAQGRRVGRDLGERCITVKADQLRRIPEVVAIAGGQ
RKGPAIDAVLRSGLVTSLVTDTSAADYLMTAGPAPKSALNRADPDGV
selected fasta
>putative transcriptional regulator [putative transcriptional regulator]
GTGAACAGCAGTGAGGAGATCGCCGTGTCCGGTATGTCGGCGGGCCGGTCAGCCATGCGG
ATGGGACCCGCTGAGCTGGTGCAGGCGGCGGCCATGGCCCGCCGCTTCTACCTCGAGGGC
AAGTCCAAGATCCAGATCGCGGAGGAGTTCGGCGTCAGCCGCTTCAAGGTGGCCCGGGTC
CTGGAGACCGCCCTCGAACGGGATCTCGTACGCATCGAGATCCGTGTGCCCGCCGAACTG
GACGCCGAGCGCTCGGACGCGCTCCGCGCCCGCTACGGCCTGCGGCACGCCGTCGTGGTC
GAGTCCCCGGCCGAGGCCGAGGAGACGCCCGACCCCGAGAACCTGGGAGAGGTGGCCGCC
GACCTGCTCGGCGAACTGGTCAACGAAGGTGATGTGCTGGGCCTGGCCTGGGGCCGCTCC
ACCATTCACATGGCGGCGGCGCTCGACCGGCTGCCGCCGTGCACGGTGGTGCAGCTGACG
GGCGTGTACGACGCCGGCACCGCCGAGCGCGGCTCGGTCGAGGCGGTACGCCGCGCCGCC
CAGGTGTCCGGGGGCGACGCCCACCCCATCTACGCCCCGATGCTGCTGCCCGACGCGGCC
ACGGCCTCCGCGCTGCGCAACCAGACCGGCATCGCCCGCGCCTTCGAGCACTTCGACAAG
GTCACCGTCGCCTGTGTCTCCATCGGCTCCTGGGAGCCGGGCATCTCCACGGTGCACGAC
ATGCTCAGCGACGAGGAACGCGCGCACTACGCCTCCCTCGGTGTCGCCGCCGAGATGTCC
GCGCACCTCTTCGACGCCCAGGGCCGCCGCGTCGGCCGGGACCTGGGCGAGCGGTGCATC
ACCGTCAAGGCCGACCAGCTGCGCCGGATCCCCGAGGTCGTCGCGATCGCGGGCGGGCAG
CGCAAGGGACCCGCGATCGACGCCGTGCTGCGCTCCGGGCTGGTCACCAGCCTGGTGACG
GACACGTCGGCGGCGGACTACCTCATGACGGCGGGCCCGGCGCCGAAGTCCGCGCTCAAC
CGGGCCGACCCGGACGGAGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007324 Sugar-binding domain, putative (Domain)
 [81-329]  1.5e-66 PF04198
PF04198   Sugar-bind
SignalP
 [1-29]  0.275 Signal
Bacteria, Gram-positive   
TMHMM No significant hit