close all open/close all

CDS information : Stref_00040


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction3,788 / 3,102 / - [in whole cluster]
3,788 / 3,102 / - [in contig]
Locationcomplement(3102..3788) [in whole cluster]
complement(3102..3788) [in contig]
TypeCDS
Length687 bp (228 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative ribulose-phosphate 3-epimerase
Product (GenBank)putative ribulose-phosphate 3-epimerase
Gene
Gene (GenBank)
EC number5.1.3.1
Keyword
Note
  • It is supposed that this ORF is not involved in steffimycin biosynthesis.
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
P46969
PmId
[8929392] Cloning and characterization of the first two genes of the non-oxidative part of the Saccharomyces cerevisiae pentose-phosphate pathway. (Curr Genet. , 1996)
[8879247] Mutants that show increased sensitivity to hydrogen peroxide reveal an important role for the pentose phosphate pathway in protection of yeast against oxidative stress. (Mol Gen Genet. , 1996)

close this sectionSequence

selected fasta
>putative ribulose-phosphate 3-epimerase [putative ribulose-phosphate 3-epimerase]
MAVQINPSILSADFARLADEAKAVEGADWLHVDVMDNHFVPNLTLGVPVVESLARATDTP
LDCHLMIEAPDRWAPQYVEAGAGSVTFHVEAAAAPVRLAREIRAKGARASMALKPATPIE
PYEDLLPELDMLLIMTVEPGFGGQAFLDIMLPKIRRTRELISKHGLELWLQVDGGVSAST
IERCADAGADVFVAGSAVYGANDPAEAVRALRTQAEAITAKASWACDH
selected fasta
>putative ribulose-phosphate 3-epimerase [putative ribulose-phosphate 3-epimerase]
ATGGCCGTGCAGATCAACCCCAGCATCCTGTCCGCAGACTTCGCCCGCCTCGCGGACGAG
GCGAAGGCCGTGGAGGGAGCCGACTGGCTCCACGTCGACGTCATGGACAACCATTTCGTC
CCGAACCTCACGCTCGGCGTGCCGGTCGTCGAGTCGCTGGCCCGTGCGACGGACACCCCG
CTGGATTGCCATCTGATGATCGAGGCCCCCGACCGGTGGGCGCCCCAGTACGTGGAGGCG
GGGGCCGGTTCCGTCACCTTCCACGTCGAGGCCGCCGCCGCCCCGGTCCGGCTCGCCCGG
GAGATCCGCGCCAAGGGTGCCCGCGCCTCCATGGCGCTGAAGCCCGCGACCCCCATCGAG
CCGTACGAGGACCTGCTCCCCGAGCTCGACATGCTGCTGATCATGACGGTCGAACCGGGC
TTCGGGGGACAGGCCTTTCTCGACATCATGCTTCCGAAGATTCGCCGCACCCGCGAGTTG
ATCAGCAAGCACGGCTTGGAGCTCTGGCTCCAGGTCGACGGCGGAGTCTCCGCTTCCACC
ATCGAGCGCTGCGCCGACGCGGGAGCCGACGTCTTCGTGGCCGGATCGGCGGTCTACGGG
GCAAACGACCCGGCAGAGGCGGTACGTGCACTACGCACACAGGCGGAGGCGATCACGGCC
AAGGCCTCCTGGGCCTGCGACCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000056 Ribulose-phosphate 3-epimerase-like (Family)
 [5-212]  1e-81 TIGR01163
TIGR01163   Rpe
 [132-154]  PS01086
PS01086   RIBUL_P_3_EPIMER_2
 [5-201]  2.50000000000001e-79 PF00834
PF00834   Ribul_P_3_epim
 [30-44]  PS01085
PS01085   RIBUL_P_3_EPIMER_1
IPR011060 Ribulose-phosphate binding barrel (Domain)
 [1-218]  1.90000694315261e-66 SSF51366
SSF51366   RibP_bind_barrel
IPR013785 Aldolase-type TIM barrel (Domain)
 [4-221]  1.60000000000002e-90 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
IPR026019 Ribulose-phosphate 3-epimerase (Family)
 [1-224]  PIRSF001461
PIRSF001461   RPE
SignalP
 [1-23]  0.121 Signal
Eukaryota   
 [1-23]  0.302 Signal
Bacteria, Gram-positive   
TMHMM No significant hit