close all open/close all

CDS information : Stref_00050


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction3,953 / 6,091 / + [in whole cluster]
3,953 / 6,091 / + [in contig]
Location3953..6091 [in whole cluster]
3953..6091 [in contig]
TypeCDS
Length2,139 bp (712 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative membrane protein
Gene
Gene (GenBank)sfrA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q53902
NITE
Actino_00150
PmId
[8636024] Production of actinorhodin-related "blue pigments" by Streptomyces coelicolor A3(2). (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>hypothetical protein [putative membrane protein]
MKQGIGHLVCGRRAKWLVVGLWLVVLFVAAPFAMKLTDAQDNDAASWLPGSAESTQVLEI
AEDFRPAQIPAVVIYARDSGLTAQDRARIAEDVTQLRELRDHGVIGERTRGPVFDRQTDP
RAAQVFVPITMDEEGWERISPAVDSIRDDVGESGAGLAVHVTGPGGTSADFAEGFEGIDS
TLLFAAMGVVIVMLLITYRSLTLLLVPLVAVVCALFTAQALIYLLAEHAGLTVNGQSAGI
LTVLVFGAGTDYALLLVARYREELRRHEDRHEAMALALHRAGPAVLASGATVVLSMLVLL
AAEMNSTRGLGPVAAIGVAVALLAMMSLFPALLVVFGRWIFWPVIPRLGTPDPTERGVWA
RMGRRIARRPRVTWGVTALALAVCSLGLIQLRAEGISNAEAFTGKPDSITGQEVSARYFP
AGSGDPLVIVSNQAQAVQVGRTVAGTEGVVPTSLGLPPGTKPAFEGRVLFEATMTAPADS
EAAKQTVERVRDAVHAVPDADAKVGGGTAALLDMDEATTHDNVLIIPLVLAVVMLILCVL
LRALIAPLLLIGTVILSFTAALGISALAFRYVFDYAGETTDFPLFVFVFLVALGIDYNIF
LTTRIREEAVRQGTRPGVVTGLATTGAVITSAGLVLAGTFAALGTLPMVAFAEIGFTVAL
GVLIDTFIVRSVLVTSLFLDAGPKVWWPHRLAKEDGAAPAVSETERVGRPGG
selected fasta
>hypothetical protein [putative membrane protein]
ATGAAGCAGGGCATTGGTCATCTCGTCTGCGGGAGACGGGCCAAGTGGCTCGTGGTGGGA
CTGTGGCTGGTGGTGCTGTTCGTCGCCGCGCCGTTCGCCATGAAGCTCACCGACGCGCAG
GACAACGACGCCGCGTCCTGGCTGCCGGGGTCCGCGGAGTCCACACAGGTGCTGGAGATC
GCCGAGGACTTCCGGCCGGCGCAGATTCCGGCGGTGGTGATCTACGCCCGGGACAGCGGG
CTGACGGCCCAGGACCGGGCCCGGATCGCCGAGGACGTCACACAGCTGAGGGAGCTGCGT
GACCACGGCGTCATCGGGGAGCGGACCAGAGGCCCCGTCTTCGACCGGCAGACCGATCCG
CGTGCGGCGCAGGTGTTCGTGCCGATCACGATGGACGAGGAGGGCTGGGAGCGGATCTCG
CCCGCCGTCGACTCCATCCGGGACGACGTCGGCGAGAGCGGTGCGGGGCTGGCCGTGCAC
GTCACCGGCCCGGGCGGCACCTCCGCGGACTTCGCCGAGGGCTTCGAGGGCATCGACTCG
ACGCTGCTGTTCGCGGCGATGGGCGTCGTCATCGTCATGCTGCTCATCACGTACCGCAGC
CTGACCCTGCTGCTGGTCCCCCTGGTGGCGGTGGTGTGCGCGCTGTTCACCGCGCAGGCG
CTGATCTATCTGCTGGCGGAGCACGCGGGCCTGACGGTCAACGGGCAGAGCGCCGGCATC
CTCACGGTGCTCGTCTTCGGCGCGGGGACGGATTACGCCCTGCTGCTCGTCGCCCGCTAC
CGGGAGGAGCTGCGCCGGCACGAGGACCGGCACGAGGCGATGGCCCTGGCGCTGCACCGC
GCGGGCCCTGCGGTGCTCGCCTCCGGCGCGACGGTCGTGCTGAGCATGCTGGTGCTGCTG
GCCGCCGAGATGAACTCCACGCGCGGCCTGGGACCGGTCGCGGCGATCGGGGTCGCGGTC
GCCCTGCTGGCGATGATGAGCCTGTTCCCCGCCCTGCTGGTGGTGTTCGGCCGGTGGATC
TTCTGGCCGGTGATCCCGCGCCTGGGCACACCCGACCCGACCGAACGCGGCGTCTGGGCG
CGCATGGGCCGGCGTATCGCCCGCCGGCCGCGGGTGACCTGGGGCGTGACGGCGCTGGCG
CTGGCGGTCTGTTCGCTGGGGCTGATCCAGCTGCGCGCGGAGGGCATCAGCAACGCGGAG
GCGTTCACCGGGAAGCCCGACTCGATCACCGGACAGGAGGTGTCGGCGCGCTACTTCCCG
GCGGGCAGCGGCGATCCCCTGGTCATCGTCAGCAACCAGGCGCAGGCCGTGCAGGTCGGC
CGCACGGTCGCCGGGACCGAGGGTGTGGTCCCCACGTCCCTGGGGCTGCCGCCCGGTACG
AAACCGGCCTTCGAGGGCAGGGTTCTCTTCGAGGCCACCATGACCGCTCCGGCGGACAGT
GAGGCCGCGAAACAGACGGTGGAGCGGGTCCGCGACGCCGTGCACGCGGTGCCGGACGCC
GACGCCAAGGTGGGCGGCGGAACGGCGGCCCTGCTGGACATGGACGAGGCGACCACGCAC
GACAACGTGCTGATCATCCCGCTGGTGCTGGCGGTCGTCATGCTGATCCTGTGCGTCCTG
CTCCGTGCGCTGATCGCGCCGCTGCTGCTGATCGGGACGGTGATCCTGTCGTTCACCGCG
GCGCTGGGCATCAGTGCGCTCGCCTTCCGCTACGTCTTCGACTACGCGGGCGAGACGACC
GACTTCCCCCTGTTCGTCTTCGTCTTCCTGGTCGCCCTGGGCATCGACTACAACATCTTC
CTGACCACTCGTATCCGCGAGGAGGCGGTCCGGCAGGGCACCAGACCGGGCGTGGTCACC
GGGCTCGCCACCACCGGCGCGGTCATCACCTCCGCCGGCCTGGTTCTGGCCGGCACCTTC
GCCGCCCTCGGCACCCTCCCGATGGTCGCCTTCGCCGAGATCGGCTTCACGGTCGCGCTG
GGTGTCCTCATCGACACGTTCATCGTGCGCTCGGTCCTGGTGACCTCCCTGTTCCTGGAC
GCAGGCCCGAAGGTGTGGTGGCCGCACCGACTGGCGAAGGAGGACGGCGCAGCGCCCGCC
GTGTCCGAGACGGAGCGGGTCGGCCGGCCCGGCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000731 Sterol-sensing domain (Domain)
 [203-335]  PS50156
PS50156   SSD
IPR004869 Membrane transport protein, MMPL type (Domain)
 [47-371]  1.10000000000001e-69 PF03176 [472-690]  1.2e-49 PF03176
PF03176   MMPL
SignalP
 [1-39]  0.955 Signal
Bacteria, Gram-positive   
 [1-39]  0.753 Signal
Eukaryota   
TMHMM
 [16-33]  Transmembrane (i-o) [177-196]  Transmembrane (o-i) [203-225]  Transmembrane (i-o) [235-257]  Transmembrane (o-i) [278-300]  Transmembrane (i-o) [315-337]  Transmembrane (o-i) [371-393]  Transmembrane (i-o) [523-545]  Transmembrane (o-i) [550-572]  Transmembrane (i-o) [582-601]  Transmembrane (o-i) [621-643]  Transmembrane (i-o) [647-669]  Transmembrane (o-i)
Transmembrane 12