close all open/close all

CDS information : Stref_00060


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction6,378 / 6,118 / - [in whole cluster]
6,378 / 6,118 / - [in contig]
Locationcomplement(6118..6378) [in whole cluster]
complement(6118..6378) [in contig]
TypeCDS
Length261 bp (86 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)acyl carrier protein
Gene
Gene (GenBank)stfS
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionPKS/NRPS Module

ACP5..79

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
MSELTLTELTTILRECAGEDENAGLRGGDVLDTTFTDLGYDSLAMLETAARIQILYGVVL
ADDVVVEAGTPRELLSLVNESLAEGP
selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
ATGAGTGAGCTGACGCTGACGGAACTGACCACGATCCTGCGCGAGTGCGCGGGCGAGGAC
GAGAACGCCGGCCTGCGGGGCGGGGACGTACTGGACACCACGTTCACGGACCTCGGATAC
GACTCCCTCGCCATGCTGGAGACCGCGGCACGCATTCAGATCCTGTACGGAGTGGTGCTG
GCCGACGACGTGGTGGTCGAGGCCGGCACGCCGCGCGAACTGCTGAGCCTGGTGAACGAG
TCGCTCGCCGAAGGTCCGTGA
ACP5..79
ACP13..237

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [37-52]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1-85]  1.09999909120787e-11 SSF47336
SSF47336   ACP_like
 [31-77]  3.4e-07 PF00550
PF00550   PP-binding
 [4-83]  9.5e-14 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [5-79]  PS50075
PS50075   ACP_DOMAIN
SignalP
 [1-18]  0.155 Signal
Eukaryota   
TMHMM No significant hit