close all open/close all

CDS information : Stref_00070


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction7,623 / 6,391 / - [in whole cluster]
7,623 / 6,391 / - [in contig]
Locationcomplement(6391..7623) [in whole cluster]
complement(6391..7623) [in contig]
TypeCDS
Length1,233 bp (410 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)chain length factor
Gene
Gene (GenBank)stfK
EC number
Keyword
  • type II PKS
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionPKS/NRPS Module

CLF4..361

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [chain length factor]
MTATVVTGMGVVAPTGLGARRHWERTVRGESAIGRITAFDARPYSGKLAGEVTGFEPSAH
LPARLLPQTDHMTRLALAAAAWAIEDASLIPAELPEFGMGVVTASSAGGFEFGHRELDKL
WRLGPEHVSAYQSFAWFYAVNSGQISIRHGLRGPSGVLVTEQAGGLDAVAQARRRVRDGT
AAMVCGSVDGSPCPWGWVAQLAGGRISTADDPARAYLPFDVDAAGHVPGDGGALFVLEDE
EGARERGVTSWHGEIAGYAATFDPPPGSARPSSLSRAIELALSDAGTEPSAIDVVFADGA
GVAELDRVEADALRTVFGPYGVPVTVPKTMTGRLSAGGAALDLATALLALRHGEIPPTVN
VSRPVPEYELDLVTQPRRGPLSAVLVVARGHGGFNAAMVVTRRRGFDRTD
selected fasta
>polyketide synthase chain length factor subunit [chain length factor]
ATGACGGCCACCGTGGTGACCGGGATGGGCGTCGTGGCGCCGACCGGTCTCGGCGCGCGA
CGGCACTGGGAACGCACGGTCAGGGGTGAGTCCGCCATCGGCCGGATCACCGCCTTCGAC
GCACGGCCGTACTCCGGGAAACTGGCGGGTGAGGTCACCGGGTTCGAGCCCTCCGCGCAC
CTGCCGGCGCGGTTGCTTCCGCAGACCGACCACATGACGCGGCTGGCGCTCGCGGCGGCC
GCCTGGGCCATCGAGGACGCGTCGCTGATCCCCGCCGAACTGCCCGAGTTCGGCATGGGA
GTGGTGACGGCGAGTTCCGCCGGCGGGTTCGAGTTCGGTCACCGTGAGCTGGACAAGCTG
TGGCGTCTGGGGCCGGAACATGTCAGCGCGTACCAGTCCTTCGCCTGGTTCTACGCGGTC
AACAGCGGCCAGATCTCGATCCGGCACGGACTGCGCGGTCCCAGCGGGGTGCTGGTCACC
GAGCAGGCGGGCGGCCTCGACGCGGTCGCGCAGGCCCGGCGGCGGGTGCGCGACGGCACG
GCCGCCATGGTCTGCGGCTCCGTCGACGGCTCGCCCTGCCCCTGGGGCTGGGTCGCACAA
CTCGCCGGCGGCCGGATCAGCACCGCCGACGATCCGGCCCGGGCGTATCTGCCCTTCGAC
GTCGACGCCGCCGGTCACGTGCCCGGCGACGGCGGGGCGCTGTTCGTGCTCGAGGACGAG
GAAGGGGCCCGGGAGCGCGGTGTGACGTCGTGGCACGGCGAGATAGCGGGTTACGCGGCG
ACCTTCGACCCACCGCCCGGCTCCGCCCGGCCGTCCTCACTGTCCAGAGCGATCGAACTC
GCCCTGTCCGACGCGGGGACCGAGCCGAGCGCCATCGACGTGGTGTTCGCGGACGGGGCG
GGAGTGGCGGAGCTCGACCGGGTGGAGGCGGACGCCCTGCGCACGGTCTTCGGGCCGTAC
GGCGTACCGGTGACGGTGCCGAAGACGATGACCGGCCGGCTCAGCGCCGGCGGAGCGGCC
CTCGATCTGGCCACCGCGCTGCTGGCACTGAGGCATGGGGAGATCCCACCCACGGTGAAC
GTCTCGCGGCCGGTGCCGGAGTACGAACTCGACCTCGTGACACAGCCCCGGCGCGGGCCG
CTGTCGGCCGTACTCGTGGTGGCTCGAGGCCACGGCGGCTTCAACGCGGCCATGGTCGTG
ACCAGACGGCGGGGATTTGACCGGACGGACTGA
CLF4..361
CLF10..1083

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-241]  2.2e-49 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [253-361]  2.2e-26 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [4-255]  7.2e-48 G3DSA:3.40.47.10 [270-402]  1.1e-35 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [1-248]  1.4e-56 SSF53901 [211-403]  3.2e-45 SSF53901
SSF53901   Thiolase-like
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [4-403]  0.00033 SM00825
SM00825   Beta-ketoacyl synthase
SignalP
 [1-18]  0.764 Signal
Eukaryota   
TMHMM No significant hit