close all open/close all

CDS information : Stref_00080


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction8,888 / 7,620 / - [in whole cluster]
8,888 / 7,620 / - [in contig]
Locationcomplement(7620..8888) [in whole cluster]
complement(7620..8888) [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)ketoacyl synthase
Gene
Gene (GenBank)stfP
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionPKS/NRPS Module

KS3..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketoacyl synthase]
MNRRVVITGIGVVAPGGTGAKKFWDLISAGRTATRRITFFDPAPFRSQVAAECDFDPRDE
GLSPQQIRRTDRSAQLALVSARECVEDSGLDLAALDPARTGAVVGSAVGCTMGLEEEYVV
VSDGGRTWQVSEEYAVPHLFNYYVPSSLAAEVAWDVGAEGPVATVSTGCTSGLDSVGQAV
ELIAEGSADVMVAGAADAPISPITMACFDAIKATTPRNDDPSTASRPFDRTRNGFVLGEG
SAMFVLEDLDHALRRGAYVYAEIAGFASRCNAFHMTGLRPDGKEMAEAIRVALARSGTAP
EDIDYINAHGSGTLQNDRHETAAFKRSLGAHAYRTPVSSIKSMIGHSLGAIGSLEIAACA
LAMRNGMVPPTANLHTPDPDCDLDYVPLVARERRVDTVLSVGSGFGGFQSAMILRRPEGK
PA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketoacyl synthase]
ATGAACCGACGAGTCGTGATCACCGGCATCGGTGTGGTCGCGCCAGGGGGCACCGGTGCC
AAGAAGTTCTGGGACCTGATCTCCGCGGGGCGTACCGCGACCCGGCGCATCACCTTCTTC
GACCCGGCCCCGTTCCGCTCGCAGGTGGCGGCCGAATGCGACTTCGACCCGAGGGACGAG
GGGCTCTCCCCCCAGCAGATCCGGCGGACGGACCGGTCGGCCCAGCTGGCGCTGGTGAGC
GCACGGGAGTGCGTAGAGGACAGCGGCCTGGATCTCGCGGCCCTCGACCCGGCACGCACC
GGCGCGGTCGTGGGCAGCGCGGTGGGCTGCACGATGGGCCTGGAGGAGGAGTACGTCGTC
GTCAGCGACGGCGGCCGCACCTGGCAGGTCTCCGAGGAGTACGCCGTCCCCCACCTCTTC
AACTACTACGTGCCGAGTTCCCTCGCGGCCGAGGTCGCTTGGGACGTCGGCGCGGAGGGC
CCCGTCGCGACGGTGTCCACCGGCTGTACGTCAGGCCTGGACTCGGTCGGACAGGCCGTC
GAGCTGATCGCGGAGGGCTCGGCCGACGTGATGGTGGCCGGTGCGGCCGACGCGCCGATC
TCACCGATCACCATGGCCTGCTTCGACGCGATCAAGGCGACCACTCCGCGCAACGACGAC
CCGTCGACGGCGTCCCGTCCCTTCGACCGCACCCGCAACGGGTTCGTGCTGGGGGAGGGA
TCCGCCATGTTCGTCCTGGAGGACCTCGACCACGCGCTCCGGCGCGGCGCGTACGTGTAC
GCCGAGATCGCCGGCTTCGCCTCCCGCTGCAACGCCTTCCACATGACCGGCCTGAGGCCG
GACGGGAAGGAGATGGCCGAGGCGATCCGGGTCGCCCTGGCCCGGTCCGGGACCGCGCCG
GAGGACATCGACTACATCAACGCCCACGGCTCGGGCACCCTGCAGAACGACCGGCACGAG
ACGGCGGCCTTCAAGCGCAGCCTCGGGGCCCACGCCTACCGGACACCGGTCAGCTCCATC
AAGTCGATGATCGGGCACTCGCTGGGCGCCATCGGCTCGCTGGAGATCGCCGCCTGCGCG
CTCGCCATGCGCAACGGGATGGTGCCGCCCACCGCCAACCTGCATACGCCGGACCCCGAC
TGCGATCTGGACTACGTGCCGCTCGTGGCCCGTGAGCGGCGCGTGGACACGGTGCTCAGC
GTGGGCAGCGGGTTCGGCGGCTTCCAGAGCGCGATGATCCTGCGCAGGCCGGAAGGGAAG
CCGGCATGA
KS3..375
KS7..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-251]  4.80000000000003e-61 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-375]  4.30000000000003e-39 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-265]  3.49999999999995e-66 G3DSA:3.40.47.10 [270-418]  1.2e-53 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-257]  2.19999900980707e-70 SSF53901 [219-418]  2.19999900980707e-67 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-19]  0.785 Signal
Eukaryota   
TMHMM No significant hit