close all open/close all

CDS information : Stref_00100


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction10,175 / 9,351 / - [in whole cluster]
10,175 / 9,351 / - [in contig]
Locationcomplement(9351..10175) [in whole cluster]
complement(9351..10175) [in contig]
TypeCDS
Length825 bp (274 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-7 ketoreductase
Product (GenBank)ketoreductase
Gene
Gene (GenBank)stfT
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q53882
NITE
Dauno_00060
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative C-7 ketoreductase [ketoreductase]
MALAAVPTFGRVTEFEENPKEDAGENADSRGVIVTGGGTGIGRATARAFADRQDRVLVVG
RSASTLTETARGYPNIHTLPVDITEPGAAETIVRAALREFGRIDVLVNNASTAVPAPLEN
IAPAEVDRLLAVNLRAPIALTREALDALTRTRGTVVNLSSAGSLGRRAWPNFSLYGSSKV
ALDFLTRTWAVELAPRGIRVVSVAPGVIETGMGIRMGSSPEEYARFLEWMEKITPLGRVG
QPEEIAWWVVQVAAPEAGFVTGTVLAVDGGASIV
selected fasta
>putative C-7 ketoreductase [ketoreductase]
GTGGCTCTAGCGGCGGTCCCTACCTTCGGCCGCGTGACCGAATTCGAGGAGAACCCGAAG
GAAGACGCCGGGGAGAACGCCGACTCCCGCGGCGTGATCGTCACCGGCGGCGGCACCGGC
ATCGGCCGGGCCACCGCGCGGGCGTTCGCCGACCGCCAGGACAGGGTCCTCGTGGTCGGC
CGGTCCGCCTCGACGCTGACCGAGACCGCCCGGGGCTACCCGAACATCCATACCCTGCCC
GTCGACATCACCGAGCCGGGAGCGGCCGAGACGATCGTGCGTGCGGCGCTCCGGGAGTTC
GGCCGGATCGACGTCCTGGTGAACAACGCCTCCACCGCCGTGCCGGCACCGCTGGAGAAC
ATCGCGCCGGCGGAGGTCGACCGGCTGCTGGCCGTCAATCTGCGTGCGCCGATCGCTCTC
ACCCGGGAAGCGCTGGACGCGCTGACCAGGACCCGCGGCACCGTGGTGAATCTCAGCAGC
GCCGGCTCCCTCGGCCGGCGTGCCTGGCCGAACTTCTCGCTCTACGGATCCAGCAAGGTC
GCCTTGGACTTCCTCACCCGGACCTGGGCCGTGGAACTGGCTCCCCGCGGAATCCGCGTG
GTCTCCGTCGCCCCGGGGGTGATCGAGACGGGCATGGGCATCCGCATGGGCTCCAGCCCC
GAGGAATACGCGCGGTTTCTGGAGTGGATGGAGAAGATCACCCCGCTCGGCCGGGTCGGA
CAGCCCGAGGAGATCGCCTGGTGGGTGGTGCAGGTCGCGGCGCCGGAGGCGGGCTTCGTC
ACGGGCACGGTGCTCGCGGTCGACGGCGGAGCGAGCATCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [101-112]  4.89999951782359e-09 PR00080 [153-161]  4.89999951782359e-09 PR00080 [175-194]  4.89999951782359e-09 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [31-48]  3.70001063537244e-36 PR00081 [101-112]  3.70001063537244e-36 PR00081 [147-163]  3.70001063537244e-36 PR00081 [175-194]  3.70001063537244e-36 PR00081 [196-213]  3.70001063537244e-36 PR00081 [235-255]  3.70001063537244e-36 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [30-273]  8.60000000000004e-75 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit