close all open/close all

CDS information : Stref_00120


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction10,818 / 11,597 / + [in whole cluster]
10,818 / 11,597 / + [in contig]
Location10818..11597 [in whole cluster]
10818..11597 [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)cyclase
Gene
Gene (GenBank)stfY
EC number
Keyword
  • 2nd and 3rd ring
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q9RN54
NITE
Nogl_00250
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
Q9L4U2
NITE
Acla_00250
PmId
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
O68500
NITE
Adria_00160
PmId
[9573189] The Streptomyces peucetius dpsY and dnrX genes govern early and late steps of daunorubicin and doxorubicin biosynthesis. (J Bacteriol. , 1998)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative cyclase [cyclase]
MRIIDLSSPVNAAAYEPDPVKHEILSPREGALHMSAEMREHFGIEFDPTDLPEGEFLSLD
RMSLTTHTGTHVDAPSHYGSRTTYGTGVPRHIDEMPLEWFHARGVVLDLTDQGTGAVGPA
ELEKAFSRIEYVPSPNEIVLLHTGADRRAGTPEYFTDFVGLDGDAVHMLLDLGVKVIGTD
AFSLDAPFGNIIERYRETGDRSVLWPAHFAGREREYCQIERLAHLGDLPEPYGFLVSCFP
VKITGAGAGWTRAVALVED
selected fasta
>putative cyclase [cyclase]
GTGCGCATCATCGACCTGTCCTCGCCCGTGAATGCCGCGGCCTATGAGCCCGACCCCGTG
AAGCACGAGATCCTCAGTCCGCGGGAGGGTGCCCTGCACATGAGCGCTGAGATGCGGGAA
CACTTCGGGATCGAATTCGATCCCACCGACCTGCCCGAAGGGGAATTCCTGTCACTGGAC
CGGATGTCCCTCACCACCCACACGGGCACCCACGTCGACGCCCCCTCCCACTACGGCTCC
CGCACCACCTACGGCACCGGGGTCCCCCGCCACATCGACGAGATGCCGTTGGAGTGGTTC
CACGCCCGCGGTGTGGTGCTGGACCTGACCGACCAGGGCACGGGAGCGGTCGGCCCAGCC
GAGCTGGAGAAGGCCTTCTCCCGGATCGAGTACGTCCCCTCCCCGAACGAGATCGTCCTG
CTGCACACCGGGGCCGACCGGCGCGCGGGCACGCCGGAGTACTTCACGGACTTCGTCGGG
CTCGACGGCGACGCCGTGCACATGCTCCTCGATCTGGGCGTGAAGGTGATCGGCACGGAC
GCGTTCAGCCTGGACGCGCCGTTCGGGAACATCATCGAGCGGTACCGGGAGACCGGCGAC
CGATCGGTCCTGTGGCCGGCCCACTTCGCCGGCCGTGAGCGGGAGTACTGCCAGATCGAG
CGTCTGGCGCATCTGGGAGACCTGCCCGAGCCGTACGGGTTCCTCGTGTCCTGCTTCCCT
GTGAAGATCACCGGCGCCGGGGCCGGCTGGACCAGGGCGGTCGCCCTGGTCGAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [3-187]  3.60000000000002e-38 PF04199
PF04199   Cyclase
SignalP No significant hit
TMHMM No significant hit