close all open/close all

CDS information : Stref_00140


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction13,301 / 12,711 / - [in whole cluster]
13,301 / 12,711 / - [in contig]
Locationcomplement(12711..13301) [in whole cluster]
complement(12711..13301) [in contig]
TypeCDS
Length591 bp (196 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)stfRII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q54821
NITE
Adria_00100
PmId
[7868594] Regulation of daunorubicin production in Streptomyces peucetius by the dnrR2 locus. (J Bacteriol. , 1995)
[8892835] The DnrN protein of Streptomyces peucetius, a pseudo-response regulator, is a DNA-binding protein involved in the regulation of daunorubicin biosynthesis. (J Bacteriol. , 1996)
[10846224] The dnrO gene encodes a DNA-binding protein that regulates daunorubicin production in Streptomyces peucetius by controlling expression of the dnrN pseudo response regulator gene. (Microbiology. , 2000)
[20122958] The activator/repressor protein DnrO of Streptomyces peucetius binds to DNA without changing its topology. (Int J Biol Macromol. , 2010)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [transcriptional regulator]
MVRVLIAEEMPMIRGALVALLSKEPDMHVVAEVGRRELVTSVALASSPHVAILNTGGIEI
APELRQKAPDINLLVVAEKAQPRLLRQALSAQVSGVILEEEPPTQLAEAVRKVAAGERII
NSKLALKALDADETPLTGRELDVLRLFASGLGPGDIARFLSLQVGTVRNYLTTIVSKLGA
RNRVDALRIAGQAGWL
selected fasta
>putative LuxR family transcriptional regulator [transcriptional regulator]
ATGGTGCGGGTGTTGATTGCGGAAGAAATGCCGATGATCCGAGGTGCCCTGGTCGCACTT
CTGAGCAAGGAGCCGGACATGCATGTCGTGGCGGAGGTAGGCCGTCGAGAATTGGTCACC
TCGGTCGCCCTGGCGAGCAGTCCCCATGTGGCCATACTGAACACCGGCGGCATAGAGATA
GCTCCGGAACTGAGGCAGAAGGCACCCGACATCAATCTCCTGGTGGTCGCCGAGAAGGCC
CAGCCCAGGCTCCTCAGGCAGGCGCTGTCCGCCCAGGTCTCGGGCGTCATCCTCGAGGAG
GAGCCGCCGACGCAGCTGGCCGAGGCCGTCCGCAAGGTCGCTGCCGGGGAACGGATCATC
AATTCGAAATTGGCACTGAAGGCACTGGATGCCGACGAGACTCCGCTGACGGGCAGGGAA
CTGGACGTGTTACGCCTGTTCGCCAGCGGATTAGGGCCCGGAGACATAGCCCGCTTTCTG
TCTCTTCAGGTCGGCACGGTCCGGAATTACCTGACGACGATCGTGTCGAAGCTGGGCGCG
AGGAACCGGGTGGACGCCCTCAGGATCGCGGGCCAGGCCGGCTGGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [133-190]  1.10000150671642e-17 SM00421
SM00421   HTH_LUXR
 [136-150]  8.70000305989074e-08 PR00038 [150-166]  8.70000305989074e-08 PR00038 [166-178]  8.70000305989074e-08 PR00038
PR00038   HTHLUXR
 [129-194]  PS50043
PS50043   HTH_LUXR_2
 [135-190]  2.3e-12 PF00196
PF00196   GerE
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [2-110]  0.000210000037262656 SM00448
SM00448   REC
 [3-114]  PS50110
PS50110   RESPONSE_REGULATORY
 [4-111]  1.3e-07 PF00072
PF00072   Response_reg
IPR011006 CheY-like superfamily (Domain)
 [1-127]  7.80000016938413e-12 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [115-196]  6.1e-21 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [114-196]  1.20000117458134e-17 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit