close all open/close all

CDS information : Stref_00150


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction13,694 / 14,623 / + [in whole cluster]
13,694 / 14,623 / + [in contig]
Location13694..14623 [in whole cluster]
13694..14623 [in contig]
TypeCDS
Length930 bp (309 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)aromatase
Gene
Gene (GenBank)stfQ
EC number
Keyword
  • 1st ring
  • unreduced polyketide
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q54490
NITE
Nogl_00320
PmId
[9268006] Isolation and characterization of 8-demethoxy steffimycins and generation of 2,8-demethoxy steffimycins in Streptomyces steffisburgensis by the nogalamycin biosynthesis genes. (J Antibiot (Tokyo). , 1997)
ACC
Q02055
NITE
Actino_00210
PmId
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [aromatase]
MPTLGKDTLQYTATVAAPAPLVFDLVAGLENWPQFHGPSVHAEPLGRRDGAEEFQHWWVI
DDRTVRTWRARWRFDSQALRIGYTYDPAEPAAPAQHGEWTFRRLSDASTEVRVEYELLGD
EGDAALADRELRELVDCVTDAAERHEERRDLVVDFEDPLFVAGAVDDAYTYLYEADKWPE
RIPHVARLVMEERVPNIQFFDMDTTTPDGSAHTTRSVRVCLPGDKIVYKQIQLPKLLTGH
TGHWKFTPTREGFVLGARHTATIKPSALPILGEGTTVLDARKYLRRVLSANSMGNLRLAK
AFAEERAGV
selected fasta
>putative cyclase/dehydratase [aromatase]
ATGCCGACTCTGGGCAAAGACACACTCCAGTACACAGCGACCGTCGCCGCGCCGGCACCG
CTGGTGTTCGATCTGGTGGCCGGACTGGAGAACTGGCCTCAATTCCACGGCCCCTCGGTG
CATGCCGAACCGCTGGGACGCCGGGACGGGGCCGAGGAGTTCCAGCACTGGTGGGTGATC
GACGACCGGACCGTGCGCACCTGGCGGGCACGCTGGCGTTTCGACAGTCAGGCGCTGCGG
ATCGGCTACACCTACGACCCGGCCGAACCGGCGGCGCCCGCACAGCACGGCGAGTGGACC
TTCCGCCGCCTGTCCGACGCGTCCACCGAAGTGCGGGTGGAGTACGAGCTCCTCGGCGAC
GAAGGTGACGCGGCCCTGGCCGACCGCGAGCTGCGGGAACTCGTGGACTGCGTCACGGAC
GCCGCCGAGCGCCACGAGGAACGCCGGGATCTGGTCGTCGACTTCGAGGACCCCTTGTTC
GTGGCGGGGGCGGTCGACGACGCGTACACCTACCTGTACGAGGCCGACAAGTGGCCGGAA
CGCATCCCTCACGTCGCCCGGCTCGTGATGGAGGAGCGGGTGCCGAACATCCAGTTCTTC
GACATGGACACCACGACGCCGGACGGCTCGGCGCACACCACCCGGTCGGTCCGCGTCTGC
CTGCCCGGCGACAAGATCGTGTACAAGCAGATCCAGCTGCCGAAGCTGCTGACAGGGCAC
ACCGGTCACTGGAAGTTCACGCCGACGCGCGAGGGATTCGTGCTCGGCGCACGGCACACC
GCGACGATCAAGCCCTCGGCGTTGCCGATCCTCGGCGAGGGCACCACGGTCCTGGACGCT
CGCAAGTACCTGCGCCGGGTGCTCAGTGCGAACAGCATGGGCAACCTGCGGCTGGCGAAG
GCGTTCGCCGAGGAGCGCGCCGGTGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005031 Streptomyces cyclase/dehydrase (Family)
 [15-117]  2.1e-06 PF03364
PF03364   Polyketide_cyc
IPR023393 START-like domain (Domain)
 [9-116]  3.5e-07 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-42]  0.139 Signal
Bacteria, Gram-negative   
TMHMM No significant hit