close all open/close all

CDS information : Stref_00160


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction14,616 / 15,293 / + [in whole cluster]
14,616 / 15,293 / + [in contig]
Location14616..15293 [in whole cluster]
14616..15293 [in contig]
TypeCDS
Length678 bp (225 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-2 O-methyltransferase
Product (GenBank)O-methyl transferase
Gene
Gene (GenBank)stfMI
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q9KHK8
NITE
Enter_00070
PmId
[11893195] Mutational analysis of the enterocin favorskii biosynthetic rearrangement. (Org Lett. , 2002)
[15505225] EncM, a versatile enterocin biosynthetic enzyme involved in Favorskii oxidative rearrangement, aldol condensation, and heterocycle-forming reactions. (Proc Natl Acad Sci U S A. , 2004)

close this sectionSequence

selected fasta
>C-2 O-methyltransferase [O-methyl transferase]
MSDQRETGPTQDQILTGTATYTRRVLSLYDTLVLGVVCRRVWQCDRAEMLAGYDRNIAER
HVDLGPGTGFFLDRCRHRTPRPRIALVDLNPLVLKKAATRLRRFAPATYQRDVLSPFELG
GERYESAGLNFLLHCLPGGMAHKARVFDHVRAHVVPGGRIFGSTVLAEGVPHGKRAYKLL
DSLNEKGTFDNRGDTLSGLEAELDARFTEYRLTVRGSVALFEARA
selected fasta
>C-2 O-methyltransferase [O-methyl transferase]
GTGTCTGACCAGCGGGAGACCGGCCCCACCCAGGACCAGATCCTCACCGGAACGGCGACC
TACACCCGCCGGGTGCTGTCCCTCTACGACACGCTCGTGCTCGGCGTCGTCTGCCGACGG
GTGTGGCAGTGCGACCGCGCGGAGATGCTGGCCGGGTACGACCGCAACATCGCCGAGCGG
CACGTCGACCTCGGCCCGGGAACCGGCTTCTTCCTCGACCGGTGCCGGCACCGGACGCCC
CGGCCTCGCATCGCCCTGGTGGATCTCAATCCGCTGGTGCTCAAGAAGGCGGCCACCCGT
CTGCGGCGGTTCGCTCCCGCCACCTACCAGCGCGACGTGCTCTCTCCGTTCGAACTCGGC
GGAGAGCGGTACGAGTCCGCCGGCCTGAACTTCCTCCTGCACTGTCTGCCGGGCGGAATG
GCCCACAAGGCCAGGGTGTTCGACCATGTGCGCGCCCATGTGGTGCCGGGTGGCCGGATC
TTCGGCAGCACGGTCCTGGCCGAGGGGGTTCCGCACGGCAAGCGGGCGTACAAGCTTCTG
GACTCGCTCAACGAGAAGGGGACTTTCGACAACCGCGGCGACACGCTCAGCGGGCTGGAA
GCCGAACTCGACGCCCGCTTCACCGAGTACCGGCTGACGGTGCGCGGGTCGGTGGCCCTC
TTCGAGGCGCGTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013217 Methyltransferase type 12 (Domain)
 [62-160]  1.2e-07 PF08242
PF08242   Methyltransf_12
IPR016584 S-adenosyl-L-methionine dependent methyltransferase, YbcY, predicted (Family)
 [1-225]  5.50001754266469e-60 PIRSF011491
PIRSF011491   Mtase_YbcY_prd
SignalP
 [1-35]  0.156 Signal
Eukaryota   
TMHMM No significant hit