close all open/close all

CDS information : Stref_00170


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction15,987 / 15,424 / - [in whole cluster]
15,987 / 15,424 / - [in contig]
Locationcomplement(15424..15987) [in whole cluster]
complement(15424..15987) [in contig]
TypeCDS
Length564 bp (187 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)SWIM Zn-finger
Gene
Gene (GenBank)stfC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [SWIM Zn-finger]
MMPAEFGATPWGRIWVRTVESTAAAGPNPALPKARSLARNHAATLTVETGRVEAEVVVSG
RTQQVRIDLPPWSDQERAEAERLVGKALAEHQNLAAGDLPDSLEADLRREKIGVAVALDD
MDAACDCRTRRRPCVHVLATLYTLSQRIDERPLLAVELRSPGWEPAAPADPDWTPLADLD
VESFYGP
selected fasta
>hypothetical protein [SWIM Zn-finger]
CTGATGCCGGCCGAATTCGGAGCCACCCCCTGGGGCAGGATCTGGGTACGAACCGTGGAG
TCGACGGCGGCGGCCGGGCCGAACCCGGCGCTGCCGAAGGCGAGGAGTCTGGCGCGCAAC
CATGCCGCCACGCTGACCGTCGAGACCGGACGCGTCGAAGCCGAGGTCGTGGTCTCGGGC
AGGACCCAGCAGGTCCGGATCGACCTGCCGCCCTGGTCCGATCAGGAGCGTGCGGAAGCC
GAACGCCTCGTCGGCAAGGCGCTGGCCGAGCACCAGAACCTTGCCGCCGGAGACCTGCCC
GACAGCCTCGAGGCGGACCTCCGGCGCGAGAAGATCGGCGTGGCCGTGGCCCTCGACGAC
ATGGACGCCGCCTGCGACTGCCGGACGCGGCGCAGGCCCTGCGTCCATGTGCTGGCCACC
CTCTACACCTTGTCCCAGCGCATCGACGAGCGTCCGCTGCTGGCCGTCGAGTTGCGCTCC
CCGGGGTGGGAGCCCGCCGCTCCCGCGGATCCCGACTGGACGCCGTTGGCCGACCTCGAC
GTGGAGTCGTTCTACGGACCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007527 Zinc finger, SWIM-type (Domain)
 [117-144]  0.00012 PF04434
PF04434   SWIM
 [112-145]  PS50966
PS50966   ZF_SWIM
SignalP
 [1-42]  0.113 Signal
Bacteria, Gram-negative   
TMHMM No significant hit