close all open/close all

CDS information : Stref_00180


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction17,840 / 15,984 / - [in whole cluster]
17,840 / 15,984 / - [in contig]
Locationcomplement(15984..17840) [in whole cluster]
complement(15984..17840) [in contig]
TypeCDS
Length1,857 bp (618 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
ProductSNF2 family protein
Product (GenBank)SNF2 related domain
Gene
Gene (GenBank)stfD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Family/Domain
FD
IPR000330, IPR001650

close this sectionSequence

selected fasta
>SNF2 family protein [SNF2 related domain]
MPELPGRLQATFVPAEGAMAWWGVADLDGAVREYGLPVGRTGTCRLALPETDHVAPATVD
VRYADLDTALPALRALDPDREAYSASLRAWRDAAVLSDAGDEPFAELSARMPAAAHAVLN
PEESAVTSAAALLGQFRQVVATRGVLRSTTVRAELRPYQMHGVAWLRSVPGRGGGAVLAD
EMGLGKTLQAICLLATRSEGGPHLVVCPTSLVGNWVRELARFSPATPVVAYHGPRRSLPD
TFEAGTVVVTSYPVLRTDEALEKTQWDVAVFDEAQQIKNPDALVSKAAARLSAEVRIAMT
GTPVENRLEELWSILNVTSPGLLGSRARFRQRFAAPIEQRRSVSAASALHALVSPHMLRR
TKAEVVAELPAKQYSTVVCTLTGEQVRLYREAVDRAFDEGLGGGIERRGRVLALLTSLKQ
ICNHPAQYLREEAAGTGRSGKFDRAAEMLAEIVDDGDRALVFTQYRVMGDLLAGHLSQHL
GTGPIPFLHGGLSPDKRDRLVHDFQESDDAPPVLLLSLRAAGFGLNLTRANHVMHYDRWW
NPAVEEQATDRAHRIGQQRTLNVHALVTGGTIEDHIAQMHETKRGFADVVSGNTEAALAE
LSDEELHAVLDLDLGALT
selected fasta
>SNF2 family protein [SNF2 related domain]
GTGCCTGAGCTGCCCGGCCGACTGCAAGCCACCTTCGTACCGGCCGAGGGGGCGATGGCC
TGGTGGGGCGTGGCCGATCTGGACGGCGCGGTACGGGAGTACGGCCTGCCGGTGGGACGC
ACCGGCACCTGCCGCCTCGCGCTGCCGGAAACGGATCACGTGGCCCCGGCGACCGTCGAC
GTCCGGTACGCCGACCTGGACACCGCACTTCCCGCTCTGCGCGCCCTGGACCCGGACCGG
GAGGCGTACAGCGCCTCGCTGCGGGCGTGGCGCGACGCCGCCGTGCTGTCCGACGCGGGT
GATGAGCCCTTCGCCGAGCTGAGCGCCCGGATGCCGGCGGCCGCCCATGCGGTGCTCAAC
CCCGAGGAGAGCGCTGTCACTTCGGCGGCCGCTCTGCTGGGCCAGTTCCGCCAGGTGGTG
GCCACCCGGGGCGTGCTGCGGTCGACGACCGTGCGGGCCGAGCTGAGGCCCTACCAGATG
CACGGTGTGGCTTGGCTGCGCTCCGTGCCCGGCCGGGGCGGAGGGGCCGTCCTGGCCGAT
GAGATGGGTCTGGGGAAGACGCTCCAGGCGATCTGTCTGCTGGCCACACGCTCGGAGGGC
GGCCCGCACCTCGTCGTCTGCCCGACCTCGCTGGTCGGCAACTGGGTCCGCGAACTGGCC
CGCTTCTCCCCGGCGACACCTGTGGTCGCCTACCACGGACCGCGCCGGAGTCTGCCGGAC
ACCTTCGAGGCCGGAACCGTGGTGGTGACCAGCTATCCGGTGCTCCGCACGGACGAGGCG
CTGGAGAAGACCCAGTGGGACGTGGCCGTCTTCGACGAGGCGCAGCAGATCAAGAATCCC
GACGCGCTGGTCAGCAAGGCCGCCGCCCGGCTGTCCGCCGAGGTGCGGATCGCCATGACC
GGTACCCCGGTGGAGAACCGGCTCGAAGAGCTGTGGTCCATCCTCAACGTGACGAGCCCC
GGCCTGCTGGGCAGCCGTGCCCGGTTCCGGCAGCGGTTCGCGGCGCCCATCGAGCAGCGC
CGCTCGGTGAGCGCCGCGAGCGCGCTGCACGCGCTCGTCTCCCCGCACATGCTCCGGCGC
ACCAAGGCCGAAGTCGTCGCGGAACTGCCCGCCAAGCAGTACTCGACGGTCGTCTGCACA
CTGACCGGCGAGCAGGTCCGGCTCTACCGCGAGGCCGTCGACCGGGCCTTCGACGAGGGG
CTCGGCGGGGGCATCGAGCGCCGGGGCCGGGTCCTGGCCCTGCTCACCTCGCTCAAGCAG
ATCTGCAATCACCCCGCCCAGTACCTGCGGGAGGAAGCCGCGGGGACCGGCCGTTCCGGC
AAGTTCGACCGGGCAGCCGAAATGCTGGCCGAGATCGTCGACGACGGCGACCGCGCCCTG
GTGTTCACCCAGTACCGGGTCATGGGGGACCTGCTGGCCGGCCACCTCTCACAACACCTC
GGCACCGGGCCGATCCCGTTCCTGCACGGCGGGCTGTCCCCCGACAAGCGAGACCGGCTC
GTGCACGACTTCCAGGAGAGCGACGACGCGCCGCCCGTCCTGCTGCTGAGCCTGCGCGCC
GCGGGGTTCGGACTCAACCTGACACGGGCCAACCACGTGATGCACTACGACCGCTGGTGG
AACCCGGCAGTGGAGGAACAGGCAACCGACCGGGCGCACCGGATCGGCCAGCAGCGCACC
CTCAACGTCCACGCCCTCGTCACCGGGGGCACCATCGAGGACCACATCGCCCAGATGCAC
GAGACCAAACGCGGGTTCGCCGACGTCGTCTCCGGCAACACCGAAGCCGCCCTGGCCGAG
CTGTCCGACGAAGAACTGCACGCCGTACTGGATCTCGACCTGGGAGCCCTCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000330 SNF2-related (Domain)
 [158-426]  2.19999999999997e-63 PF00176
PF00176   SNF2_N
IPR001650 Helicase, C-terminal (Domain)
 [444-602]  PS51194
PS51194   HELICASE_CTER
 [470-556]  1.20000117458134e-22 SM00490
SM00490   HELICc
 [487-556]  4.00000000000001e-12 PF00271
PF00271   Helicase_C
IPR014001 Helicase, superfamily 1/2, ATP-binding domain (Domain)
 [167-321]  PS51192
PS51192   HELICASE_ATP_BIND_1
 [151-332]  3.80000697093586e-30 SM00487
SM00487   DEXDc
SignalP
 [1-20]  0.244 Signal
Eukaryota   
TMHMM No significant hit