close all open/close all

CDS information : Stref_00190


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction19,341 / 17,833 / - [in whole cluster]
19,341 / 17,833 / - [in contig]
Locationcomplement(17833..19341) [in whole cluster]
complement(17833..19341) [in contig]
TypeCDS
Length1,509 bp (502 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productsteffimycin resistance transporter
Product (GenBank)putative transmembrane efflux protein
Gene
Gene (GenBank)sfrB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>steffimycin resistance transporter [putative transmembrane efflux protein]
MTFLPEEQVVSSSPTATMARRGRTLALVVILLAMFIDLIGVTILNVVLPSIQTGLDASPA
ALQWMQAGYTLALALGIVCGARLGDMLGHKRVFIAGMWGFAAASALCAVAVGPEMLVAAR
VVQGAFAAAVIPQVLSQIQVMYTAEERGGPMAAYASLSGLAATLGPIVGPALLEWDLAGS
GWRMAFWVNVPLSVLVALTSMKLLPDSRTTGAARIDVMGVVISTVGLLLVLYPLIEAADP
TKRTVWSYVSIAAGVVVLGLFALYERRVSARGGDPLLEMSLFRFRSVQGGLLVQLLFFVP
AMGFFLVFMLFLQHGVGMSPMESGLMMLPWSVAVPVFATISAAVLLPKIGRLTVQIGLVV
MAAGFALIALAAAGATQQTGWGELFWGVLVGGVGMGMLVAPLMQLTLSDMPVESAGSGSA
LYNTITQLAASVGVAVIGTVFFNGIEDVAHTPAAAAEGYGDALATSLWLGVGLLAVALAS
SFLLPRGPVAATEAPSGEVVSA
selected fasta
>steffimycin resistance transporter [putative transmembrane efflux protein]
ATGACGTTCCTGCCCGAGGAGCAAGTAGTGTCCAGCAGTCCCACGGCGACGATGGCGAGG
CGTGGCCGCACCCTGGCCCTGGTCGTCATCCTGCTCGCGATGTTCATCGACCTCATCGGT
GTCACCATCCTCAACGTCGTCCTGCCCTCGATCCAGACGGGGCTCGACGCGAGCCCGGCC
GCACTGCAGTGGATGCAGGCCGGCTACACGCTGGCGCTCGCCCTGGGAATCGTGTGCGGT
GCCCGGCTGGGGGACATGCTGGGCCACAAACGCGTGTTCATCGCCGGCATGTGGGGCTTC
GCGGCCGCGTCAGCGCTGTGCGCGGTCGCGGTGGGACCGGAGATGCTGGTCGCCGCGAGG
GTGGTACAGGGGGCGTTCGCCGCGGCGGTGATCCCGCAGGTGCTGTCCCAGATCCAGGTC
ATGTACACCGCGGAGGAACGCGGCGGCCCGATGGCGGCGTACGCGTCGCTGTCCGGCCTC
GCCGCCACGCTGGGACCCATCGTCGGCCCCGCCCTGCTCGAGTGGGACCTGGCCGGCTCG
GGCTGGCGCATGGCGTTCTGGGTGAACGTCCCGCTCTCCGTGCTGGTCGCGCTGACCTCC
ATGAAACTGCTCCCGGACAGCCGTACGACCGGCGCCGCCCGGATCGACGTCATGGGCGTC
GTCATCTCCACGGTGGGTCTGCTGCTGGTGCTGTACCCCTTGATCGAGGCCGCGGACCCG
ACCAAGCGGACCGTCTGGTCGTACGTGTCGATCGCGGCGGGCGTGGTGGTGCTCGGCCTG
TTCGCGCTCTACGAGCGCCGGGTCAGCGCGCGGGGCGGGGATCCGCTGCTGGAGATGTCG
CTGTTCAGGTTCCGCTCCGTGCAGGGCGGTCTGCTCGTGCAACTGCTGTTCTTCGTCCCG
GCGATGGGTTTCTTCCTGGTCTTCATGCTGTTCCTTCAGCACGGAGTCGGCATGAGCCCG
ATGGAGTCGGGCCTGATGATGCTTCCCTGGTCGGTGGCGGTCCCGGTGTTCGCCACGATC
TCGGCGGCCGTGCTCCTGCCGAAGATCGGTCGGCTGACCGTGCAGATCGGGCTGGTCGTG
ATGGCGGCCGGGTTCGCCCTGATCGCGCTCGCGGCCGCCGGGGCCACCCAGCAGACGGGC
TGGGGCGAACTGTTCTGGGGTGTGCTGGTCGGCGGCGTGGGTATGGGCATGCTCGTGGCA
CCCCTGATGCAGCTGACGCTGAGTGACATGCCCGTGGAGTCCGCCGGATCGGGGTCCGCG
CTGTACAACACGATCACCCAGCTGGCCGCCTCGGTCGGCGTGGCGGTGATCGGCACCGTC
TTCTTCAACGGCATCGAGGACGTCGCGCACACCCCCGCCGCTGCCGCCGAGGGATACGGC
GACGCGCTCGCGACCTCGCTGTGGCTGGGCGTGGGCCTGCTGGCGGTCGCGCTCGCCAGC
AGTTTCCTGCTGCCGCGCGGCCCGGTCGCGGCGACCGAAGCGCCCTCCGGCGAGGTGGTC
AGTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [30-433]  8.79999999999995e-38 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-492]  3.29999077503323e-63 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [26-488]  PS50850
PS50850   MFS
SignalP
 [1-40]  0.408 Signal
Eukaryota   
TMHMM
 [25-47]  Transmembrane (i-o) [62-84]  Transmembrane (o-i) [91-112]  Transmembrane (i-o) [116-138]  Transmembrane (o-i) [151-173]  Transmembrane (i-o) [183-205]  Transmembrane (o-i) [217-235]  Transmembrane (i-o) [245-264]  Transmembrane (o-i) [290-312]  Transmembrane (i-o) [327-346]  Transmembrane (o-i) [353-375]  Transmembrane (i-o) [385-407]  Transmembrane (o-i) [420-442]  Transmembrane (i-o) [462-484]  Transmembrane (o-i)
Transmembrane 14