close all open/close all

CDS information : Stref_00200


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction19,419 / 19,919 / + [in whole cluster]
19,419 / 19,919 / + [in contig]
Location19419..19919 [in whole cluster]
19419..19919 [in contig]
TypeCDS
Length501 bp (166 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative MarR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)stfRIII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Family/Domain
FD
IPR000835

close this sectionSequence

selected fasta
>putative MarR family transcriptional regulator [putative transcriptional regulator]
MTKKQQETAENGVKESLADQIIGTLPAWITQLIQINNLIADRMGVVSTDFHCLHALHQDG
PTTASVLAGRVGLTPGSTSRMIDRLADAGCIKRVPDPGDRRRILIEPTEEGLDRITTYYA
GLTARTHGDLADFDTDQLRTLLRFVEAARDSASAEVDRLRSEPAQG
selected fasta
>putative MarR family transcriptional regulator [putative transcriptional regulator]
ATGACGAAGAAGCAGCAGGAAACAGCCGAAAACGGCGTCAAGGAGTCGCTGGCCGACCAG
ATCATCGGCACGCTGCCGGCGTGGATCACTCAGCTCATCCAGATCAACAACCTGATCGCC
GATCGCATGGGCGTGGTGTCGACCGACTTCCACTGCCTGCACGCGTTGCACCAGGACGGT
CCGACCACGGCCAGCGTGCTGGCCGGCCGGGTGGGTCTCACTCCGGGCTCGACGTCGCGC
ATGATCGACCGGCTGGCCGACGCGGGGTGCATCAAACGGGTGCCGGACCCGGGCGATCGC
CGGCGGATCCTCATCGAGCCGACGGAGGAGGGCCTCGACCGGATCACCACCTACTACGCG
GGGCTGACCGCCCGCACCCACGGGGATCTGGCGGATTTCGACACCGACCAGCTGCGCACG
CTGCTGCGTTTCGTCGAGGCGGCCCGCGACAGCGCGAGCGCGGAGGTCGACCGGCTCCGC
TCGGAGCCCGCGCAGGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000835 Transcription regulator HTH, MarR-type (Family)
 [38-138]  3.89999861795218e-19 SM00347
SM00347   HTH_MARR
 [48-102]  6.3e-15 PF01047
PF01047   MarR
 [1-150]  PS50995
PS50995   HTH_MARR_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [6-148]  3.60000000000001e-29 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit