close all open/close all

CDS information : Stref_00220


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction21,249 / 22,829 / + [in whole cluster]
21,249 / 22,829 / + [in contig]
Location21249..22829 [in whole cluster]
21249..22829 [in contig]
TypeCDS
Length1,581 bp (526 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative FAD-dependent oxidoreductase
Product (GenBank)dehydrogenase
Gene
Gene (GenBank)stfE
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q9ALN1
NITE
Spino_00120
PmId
[17985910] The biosynthesis of spinosyn in Saccharopolyspora spinosa: synthesis of the cross-bridging precursor and identification of the function of SpnJ. (J Am Chem Soc. , 2007)
ACC
Q0PCD7
NITE
Acla_00150
PmId
[17242508] Structure determination by multiwavelength anomalous diffraction of aclacinomycin oxidoreductase: indications of multidomain pseudomerohedral twinning. (Acta Crystallogr D Biol Crystallogr. , 2007)
[17395717] Aclacinomycin oxidoreductase (AknOx) from the biosynthetic pathway of the antibiotic aclacinomycin is an unusual flavoenzyme with a dual active site. (Proc Natl Acad Sci U S A. , 2007)

close this sectionSequence

selected fasta
>putative FAD-dependent oxidoreductase [dehydrogenase]
MTDGAILAGLATGLSPATSAAAPAEACGPDVGPVTVTPDDPRYEELTTAGNARFHCRPRQ
IRVVGSTAQVVQAVQDAVRSGARVVARSGGHCLEDFVDSPTTQLLVDLSEMTAVGYDETR
AAFVVQPGALLGNVYRTLLKGWGVTLPAGLTSTVGIGGHVLGGGYGPLTRLHGCVVDHLY
GVEVVVVDRSGTARAVVATRDADDPNRDLWWAHTGGGGGNFGIVTRYWFRTPGVDSSDPG
QLLPAPPAAVLDSYVQWSWADMTEKSFRRLLRNHGRWHERNNAPDSPYAALFSILTALRR
QSGVFSLSTQLDAGLPDAESMVDGYVAAVTEGVGVPYTHDVRTTPWLRSMLYPRVADNVF
GLRAKCKAAYLRRAFADSQADTIYRRLTGEDYDNPAAGILLAAYGGKVSTVPPDATATAQ
RDAVLKAFFFDTWTDPAADERNIRWMREFYREVFADTGGVPVPGEISDGSYINYPDTDLA
DPRWNTSGTPWHTLYYKDNYARLQRVKARWDPRDVFHHALSIRPSA
selected fasta
>putative FAD-dependent oxidoreductase [dehydrogenase]
ATGACCGACGGAGCCATACTGGCCGGTCTGGCGACCGGCCTGAGCCCGGCGACCTCGGCG
GCCGCCCCCGCCGAGGCGTGCGGTCCGGACGTCGGACCGGTGACGGTCACCCCGGACGAC
CCCCGGTACGAGGAACTGACGACCGCGGGAAACGCCAGGTTCCATTGCCGCCCCCGCCAG
ATCCGGGTGGTCGGCTCGACCGCGCAGGTCGTCCAGGCGGTCCAGGACGCGGTGCGATCC
GGCGCCCGGGTGGTTGCGCGCAGCGGCGGCCACTGCCTGGAGGACTTCGTCGACTCCCCC
ACCACGCAGCTGCTGGTCGACCTGTCCGAGATGACAGCGGTCGGCTACGACGAGACCCGC
GCCGCGTTCGTCGTACAGCCCGGCGCACTGCTCGGAAACGTGTACCGCACCCTGCTCAAG
GGCTGGGGCGTGACGCTGCCCGCGGGCCTGACCTCGACGGTCGGGATCGGCGGGCATGTG
CTCGGCGGGGGCTACGGTCCCCTGACCCGGCTGCACGGCTGTGTCGTGGACCATCTGTAC
GGTGTCGAGGTCGTGGTGGTGGACCGCTCCGGCACCGCGAGGGCCGTCGTGGCCACCCGG
GACGCCGACGACCCGAACCGGGATCTGTGGTGGGCGCACACGGGAGGCGGGGGCGGCAAC
TTCGGCATCGTCACGCGCTACTGGTTCCGGACGCCCGGTGTCGACAGCTCCGATCCCGGG
CAGCTGCTGCCCGCGCCGCCCGCCGCCGTACTGGACAGCTACGTCCAGTGGTCGTGGGCG
GACATGACAGAGAAGTCCTTCCGCCGGTTGCTGCGCAACCACGGGCGCTGGCACGAACGG
AACAACGCGCCCGACTCGCCGTACGCCGCGCTGTTCAGCATCCTGACGGCCCTGCGCAGG
CAGTCGGGCGTGTTCTCTTTGAGCACCCAGCTCGACGCCGGGCTTCCGGACGCGGAGAGC
ATGGTCGACGGCTATGTGGCGGCCGTCACGGAGGGGGTCGGGGTGCCGTACACCCACGAC
GTCCGGACGACACCGTGGCTGCGCTCCATGCTGTACCCCCGAGTGGCCGACAACGTCTTC
GGGCTTCGTGCGAAGTGCAAGGCCGCTTATCTGCGCAGGGCTTTCGCGGATTCCCAGGCG
GACACGATCTACCGCAGGCTGACCGGCGAGGACTACGACAATCCGGCCGCGGGCATCCTC
CTCGCCGCATACGGCGGAAAGGTGTCCACGGTGCCGCCCGACGCCACGGCCACGGCGCAG
CGTGACGCCGTGCTGAAGGCGTTCTTCTTCGACACCTGGACCGACCCGGCGGCGGACGAG
CGCAACATCCGGTGGATGCGGGAGTTCTACCGGGAGGTCTTCGCCGACACCGGTGGTGTC
CCGGTGCCCGGGGAGATCAGCGACGGTTCCTACATCAACTATCCCGACACCGACCTGGCG
GACCCCCGGTGGAACACGTCGGGCACGCCGTGGCACACGCTGTACTACAAGGACAACTAC
GCCCGGCTGCAGCGGGTGAAGGCCCGCTGGGATCCCCGCGACGTCTTCCACCACGCCCTG
TCGATCCGGCCGTCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006094 FAD linked oxidase, N-terminal (Domain)
 [58-187]  6.50000000000001e-19 PF01565
PF01565   FAD_binding_4
IPR012951 Berberine/berberine-like (Domain)
 [470-523]  1.99999999999999e-19 PF08031
PF08031   BBE
IPR016166 FAD-binding, type 2 (Domain)
 [29-234]  2.69998997787809e-35 SSF56176
SSF56176   FAD-binding_2
 [54-234]  PS51387
PS51387   FAD_PCMH
IPR016167 FAD-binding, type 2, subdomain 1 (Domain)
 [30-127]  0.00023 G3DSA:3.30.43.10
G3DSA:3.30.43.10   FAD-binding_2_sub1
IPR016168 FAD-linked oxidase, FAD-binding, subdomain 2 (Domain)
 [128-229]  4e-07 G3DSA:3.30.465.20
G3DSA:3.30.465.20   FAD-linked_oxidase_FAD-bd_sub2
SignalP
 [1-21]  0.999 Signal
Bacteria, Gram-negative   
 [1-26]  0.998 Signal
Bacteria, Gram-positive   
 [1-21]  0.996 Signal
Eukaryota   
TMHMM No significant hit