close all open/close all

CDS information : Stref_00230


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction24,050 / 22,887 / - [in whole cluster]
24,050 / 22,887 / - [in contig]
Locationcomplement(22887..24050) [in whole cluster]
complement(22887..24050) [in contig]
TypeCDS
Length1,164 bp (387 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)putative oxygenase
Gene
Gene (GenBank)stfOII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
P0ABR5
PmId
[9603882] Characterization of the hca cluster encoding the dioxygenolytic pathway for initial catabolism of 3-phenylpropionic acid in Escherichia coli K-12. (J Bacteriol. , 1998)
[9205837] Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features. (DNA Res. , 1997)
Family/Domain
FD
IPR017941

close this sectionSequence

selected fasta
>putative oxidoreductase [putative oxygenase]
MGHSLDRAVPGDVTSPPSTADLLEELRGYLRADPPAISLPPRLFTSPDVYESERARIFGR
SWMMVAHRDQLAQPGDYLALEIAGEPVVITRGDDGMLHGMSPVCRHRMMPLVEPGSGNTQ
DFTCPYHLWRYRLDGTLLAATHMRGNADFDPGQCRLPAFAVEEWRGFVFVNLQADASTLE
DHLTGVDGDLANYRLDDMVQISTWTEVWRCNWKVAVENSYENYHAIGFHPNTVKPLMTGG
IDMEVHADSPLVTRLLTRTGEPMEPSVLPLTEEEKRVLYSFRMFPCSSLATFGESIAWIS
LIPLSIDRTEVRGGTLMPAAALEGADVEAIRKQTEQFTGVINTEDRLGLEAVQRTLGSRF
IERGHLSPKEPGVLAFYRNLALALAAD
selected fasta
>putative oxidoreductase [putative oxygenase]
ATGGGCCATTCCCTCGACCGGGCGGTACCGGGCGACGTCACGTCACCACCGTCGACCGCG
GACCTGCTGGAGGAGCTGCGCGGCTATCTCCGGGCGGATCCTCCCGCGATCAGCCTGCCG
CCTCGGCTGTTCACCTCACCCGACGTCTACGAATCCGAACGCGCCCGGATCTTCGGCCGC
TCCTGGATGATGGTGGCGCACCGGGACCAGCTGGCGCAGCCCGGTGACTACCTCGCACTC
GAGATCGCCGGCGAGCCGGTGGTGATCACCCGGGGCGACGACGGCATGCTGCACGGCATG
TCACCGGTCTGCCGGCACCGCATGATGCCGCTGGTCGAACCCGGTTCGGGCAACACCCAG
GACTTCACCTGCCCCTATCACTTGTGGCGCTACCGCCTCGACGGCACGCTCCTGGCCGCC
ACGCACATGCGGGGCAACGCCGACTTCGATCCCGGACAGTGCCGGCTGCCCGCGTTCGCC
GTGGAGGAATGGCGGGGGTTCGTCTTCGTCAACCTCCAGGCCGACGCCTCGACGCTGGAG
GACCATCTAACCGGCGTGGACGGGGACCTGGCCAACTACCGACTCGACGACATGGTCCAG
ATCTCCACCTGGACCGAGGTCTGGCGGTGCAACTGGAAGGTCGCGGTGGAGAACAGCTAC
GAGAATTACCACGCGATCGGTTTCCATCCCAACACGGTGAAACCGCTCATGACCGGCGGC
ATCGACATGGAGGTGCACGCCGACTCGCCCCTGGTCACCCGGCTGCTCACCCGGACCGGC
GAGCCGATGGAGCCCTCGGTCCTGCCGCTGACCGAGGAGGAGAAGAGGGTGCTGTACAGC
TTCCGGATGTTTCCGTGCAGCAGCCTGGCGACCTTCGGCGAGAGCATCGCCTGGATCAGT
CTCATCCCGCTGTCCATCGACCGGACGGAGGTGCGCGGCGGGACGCTGATGCCGGCGGCG
GCGCTCGAGGGCGCCGATGTGGAGGCGATCCGTAAGCAGACCGAGCAGTTCACGGGTGTG
ATCAACACCGAGGACCGGCTCGGCCTGGAGGCCGTCCAGCGGACGCTCGGCTCCCGGTTC
ATCGAACGGGGACACCTCAGCCCCAAGGAGCCCGGGGTGCTGGCCTTCTACCGCAACCTC
GCCCTGGCGCTGGCAGCGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001663 Aromatic-ring-hydroxylating dioxygenase, alpha subunit (Domain)
 [46-71]  2.90000354677981e-27 PR00090 [76-91]  2.90000354677981e-27 PR00090 [97-117]  2.90000354677981e-27 PR00090 [118-138]  2.90000354677981e-27 PR00090 [159-185]  2.90000354677981e-27 PR00090 [196-218]  2.90000354677981e-27 PR00090
PR00090   RNGDIOXGNASE
IPR015879 Aromatic-ring-hydroxylating dioxygenase, alpha subunit, C-terminal domain (Domain)
 [195-385]  1.8e-28 PF00848
PF00848   Ring_hydroxyl_A
IPR017941 Rieske [2Fe-2S] iron-sulphur domain (Domain)
 [62-170]  PS51296
PS51296   RIESKE
 [61-155]  5.30000000000001e-18 PF00355
PF00355   Rieske
 [22-175]  4.90001027782408e-46 SSF50022
SSF50022   Rieske_dom
 [60-169]  4.70000000000003e-35 G3DSA:2.102.10.10
G3DSA:2.102.10.10   Rieske_reg
SignalP
 [1-38]  0.044 Signal
Bacteria, Gram-negative   
TMHMM No significant hit