close all open/close all

CDS information : Stref_00240


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction25,243 / 24,068 / - [in whole cluster]
25,243 / 24,068 / - [in contig]
Locationcomplement(24068..25243) [in whole cluster]
complement(24068..25243) [in contig]
TypeCDS
Length1,176 bp (391 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)O-methyl transferase
Gene
Gene (GenBank)stfMII
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
O54261
NITE
Nogl_00410
PmId
[22120896] Identification of late-stage glycosylation steps in the biosynthetic pathway of the anthracycline nogalamycin. (Chembiochem. , 2012)
ACC
Q2P9Y7
NITE
Stref_00280
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative O-methyltransferase [O-methyl transferase]
MSAESDLLDRVIRAGTASDAEISELVEEAGLDAVIGVLVDEVLFRCDEPVNATPVDIALD
LTHGTERRRTVFRIVRDEPIEIVDAEEPVIRRELRMDVRDLVRRLYGRADHRRAGDFYDT
FLPTRPEHLWELPAILAATNQASGTLLSGCTVPHVDLGALSVAHGSDKWASFHWYTAHYQ
KEFAPYRDQPVRLLEIGIGGFEGELGGPSLKMWKRYFHRGAVFGLDLFDKSALNQPRLTA
LVGDQGDTETLVAIAEEHGPFDIVIDDGSHENEHVRTSFDSLFPYVRSGGLYVIEDLQTS
YFPRFGGTAGDEAGPQTSVGLLKRLLDDLHYQEQEARTDEPPTVTQDAVVGVRVYRNIAF
IEKGVNGENGIPRWMDDEAWVALGAIPPAAE
selected fasta
>putative O-methyltransferase [O-methyl transferase]
ATGTCCGCTGAGAGTGACCTGCTCGACCGCGTGATCCGGGCGGGGACCGCTTCCGACGCG
GAGATCTCCGAGCTGGTCGAGGAGGCCGGACTCGACGCGGTGATCGGTGTTCTCGTCGAC
GAAGTGCTGTTCCGTTGCGACGAACCGGTCAACGCGACACCCGTCGACATCGCGCTGGAC
CTCACGCACGGGACCGAACGGCGACGGACCGTCTTCCGCATCGTCCGGGACGAGCCCATC
GAGATCGTCGACGCCGAGGAGCCGGTGATCCGGCGCGAACTGCGCATGGACGTCAGGGAC
CTGGTGCGCCGGCTGTACGGGCGGGCGGACCATCGTCGTGCCGGGGACTTCTACGACACC
TTCCTGCCCACCCGCCCCGAGCATCTGTGGGAGCTGCCGGCGATCCTCGCGGCGACCAAC
CAGGCCTCCGGCACACTGCTCTCCGGCTGCACCGTCCCCCACGTCGACCTCGGGGCGCTG
TCCGTCGCCCACGGATCGGACAAGTGGGCCAGCTTCCACTGGTACACGGCCCACTACCAG
AAGGAGTTCGCCCCATACCGGGACCAGCCCGTGCGGCTGCTCGAGATCGGGATCGGCGGC
TTCGAAGGGGAACTCGGCGGACCGTCCCTGAAGATGTGGAAGAGGTACTTCCACCGCGGT
GCAGTCTTCGGTCTCGACCTGTTCGACAAGTCCGCCCTGAACCAGCCCAGGCTGACCGCG
CTGGTCGGCGATCAGGGCGACACCGAAACCCTGGTCGCCATCGCGGAAGAGCACGGCCCC
TTCGACATCGTCATCGACGACGGCAGTCACGAGAACGAGCATGTGCGCACCTCGTTCGAC
TCGCTCTTCCCCTACGTGCGCAGCGGTGGCCTCTACGTCATCGAGGACCTGCAGACCTCG
TACTTCCCGAGGTTCGGGGGAACGGCGGGTGACGAGGCCGGACCGCAGACCTCGGTGGGG
CTGCTCAAGCGGCTGCTGGACGACCTGCATTACCAGGAACAGGAAGCGCGGACCGACGAG
CCCCCGACCGTGACCCAGGACGCCGTGGTCGGTGTACGGGTCTATCGGAACATCGCGTTC
ATCGAGAAGGGCGTCAACGGGGAGAACGGCATCCCCAGGTGGATGGACGACGAGGCCTGG
GTGGCCCTGGGCGCGATACCCCCGGCGGCGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-17]  0.042 Signal
Eukaryota   
TMHMM No significant hit