close all open/close all

CDS information : Stref_00250


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction25,574 / 25,233 / - [in whole cluster]
25,574 / 25,233 / - [in contig]
Locationcomplement(25233..25574) [in whole cluster]
complement(25233..25574) [in contig]
TypeCDS
Length342 bp (113 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productmuconolactone delta-isomerase family protein
Product (GenBank)putative 5-chloromuconolactone dehalogenase
Gene
Gene (GenBank)stfF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q8G9L0
PmId
[12218013] A new modified ortho cleavage pathway of 3-chlorocatechol degradation by Rhodococcus opacus 1CP: genetic and biochemical evidence. (J Bacteriol. , 2002)
[12957954] Conversion of 2-fluoromuconate to cis-dienelactone by purified enzymes of Rhodococcus opacus 1cp. (Appl Environ Microbiol. , 2003)

close this sectionSequence

selected fasta
>muconolactone delta-isomerase family protein [putative 5-chloromuconolactone dehalogenase]
MALFAVLATQAPAAGEREEFLRRLPEGFAYTKDLVDKGVIRHSWIRVGASGGLNIYDVDS
HEELLSVLYSNPVSPHLTFEVIPLAVPESFDPAAYLLKWNKKDGSRDEARHVR
selected fasta
>muconolactone delta-isomerase family protein [putative 5-chloromuconolactone dehalogenase]
ATGGCGCTGTTCGCGGTACTCGCCACACAGGCACCGGCAGCGGGAGAACGGGAGGAATTC
CTGCGCCGGCTTCCCGAAGGATTCGCCTACACGAAAGACCTGGTGGACAAAGGTGTGATC
CGGCACAGCTGGATCCGGGTCGGCGCGTCCGGCGGTCTGAACATCTACGACGTCGATTCG
CACGAGGAGTTGCTCTCCGTGCTCTACAGCAACCCGGTCAGTCCGCATCTGACCTTCGAG
GTCATTCCCCTGGCCGTTCCGGAGAGCTTCGACCCGGCGGCCTATCTGCTCAAGTGGAAC
AAGAAGGACGGTTCCAGGGATGAGGCCCGGCATGTCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-96]  1.10000150671642e-20 SSF54909
SSF54909   Dimer_A_B_barrel
IPR026029 Muconolactone isomerase domain (Domain)
 [29-85]  1.1e-08 PF02426
PF02426   MIase
SignalP
 [1-15]  0.955 Signal
Eukaryota   
TMHMM No significant hit