close all open/close all

CDS information : Stref_00270


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction28,077 / 26,977 / - [in whole cluster]
28,077 / 26,977 / - [in contig]
Locationcomplement(26977..28077) [in whole cluster]
complement(26977..28077) [in contig]
TypeCDS
Length1,101 bp (366 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase helper protein
Product (GenBank)cytochrome P450-like
Gene
Gene (GenBank)stfPII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q9L4U5
NITE
Acla_00220
PmId
[15911373] AknT is an activating protein for the glycosyltransferase AknS in L-aminodeoxysugar transfer to the aglycone of aclacinomycin A. (Chem Biol. , 2005)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)
ACC
Q54823
NITE
Adria_00350
PmId
[7592454] Cloning and characterization of the Streptomyces peucetius dnrQS genes encoding a daunosamine biosynthesis enzyme and a glycosyl transferase involved in daunorubicin biosynthesis. (J Bacteriol. , 1995)
[17049185] Functional analysis of desVIII homologues involved in glycosylation of macrolide antibiotics by interspecies complementation. (Gene. , 2007)

close this sectionSequence

selected fasta
>putative glycosyltransferase helper protein [cytochrome P450-like]
MEIRTDSELGRSLLTERGMQWLHAHSGDPYARLLRAEDEDRRALGAQIRELGPLYRSRTG
AWVTGSGVLGAEILRDPRLEPLAPYVGRAQLTTVDADGPALPGPAARDAERLCGEALGRT
AGGFDLVSDVLRPVVVRLTGELLAVPPERRGTFERLCGAVAPALDAGLCPPTLPRARALI
DAVEGLRSLLAESAGPRDARMRACVVGVEVTTNVVANAMLALLERPEQWRLVCDDPRRAE
AAVEETLRCDPPVRLDGRVAREDLELAGRTVTAGDEVVVHIEAANQDAGPSRDPERFDLR
RATATGHLCLLEGTRFGAVAPQVRIFGAAVLRALAARAPDLRRTGSVVRRLRAPVTQAVV
RFPVAA
selected fasta
>putative glycosyltransferase helper protein [cytochrome P450-like]
GTGGAGATTCGGACGGACAGTGAACTCGGGCGGTCCCTGCTGACCGAGCGAGGTATGCAA
TGGCTGCACGCACACAGCGGAGACCCCTATGCACGGCTGCTGCGCGCGGAGGACGAGGAC
CGCCGGGCCCTCGGCGCACAGATCAGGGAACTCGGACCGCTGTACCGCAGCCGCACCGGG
GCGTGGGTCACCGGTAGCGGTGTGCTGGGCGCGGAGATTCTCCGTGATCCACGGCTGGAG
CCGCTCGCGCCGTACGTCGGGCGCGCCCAGCTGACGACGGTGGACGCCGACGGGCCGGCC
CTCCCCGGTCCGGCGGCCCGCGATGCCGAGCGGTTGTGCGGTGAGGCACTCGGCCGGACG
GCCGGCGGGTTCGACCTGGTCTCGGACGTCCTGCGTCCGGTCGTGGTCCGCCTGACCGGT
GAGCTGCTGGCCGTACCGCCCGAACGGCGAGGGACCTTCGAGCGGTTGTGCGGCGCGGTG
GCGCCCGCGCTGGACGCCGGGCTGTGCCCACCGACGCTGCCCCGCGCACGGGCACTGATC
GACGCGGTCGAGGGCCTGCGGTCCCTCCTCGCGGAGTCGGCCGGGCCGCGGGACGCGCGG
ATGCGGGCGTGCGTCGTGGGCGTCGAGGTGACGACGAACGTCGTCGCGAACGCGATGCTC
GCGCTCCTCGAGCGGCCGGAACAGTGGCGGTTGGTGTGCGACGACCCGCGACGCGCGGAG
GCGGCGGTGGAGGAAACGCTGCGCTGCGACCCGCCGGTCCGGCTCGATGGCCGAGTCGCA
CGAGAGGACCTGGAACTCGCGGGCCGGACGGTGACCGCGGGGGACGAGGTGGTCGTCCAC
ATCGAGGCGGCGAACCAGGACGCCGGGCCGTCGCGCGACCCCGAGCGGTTCGACCTGCGG
CGCGCTACCGCGACCGGGCATCTCTGCCTGCTCGAGGGAACGCGATTCGGTGCCGTGGCA
CCACAGGTGCGGATCTTCGGCGCCGCGGTGCTCCGGGCGCTGGCCGCCCGGGCGCCGGAT
CTGCGCCGGACCGGGTCCGTGGTGCGCCGTCTGCGGGCGCCGGTCACCCAGGCCGTCGTC
AGGTTCCCGGTCGCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [205-365]  5.59999999999999e-35 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [240-301]  9e-07 PF00067
PF00067   p450
 [41-364]  1.89999859865865e-29 SSF48264
SSF48264   Cytochrome_P450
SignalP No significant hit
TMHMM No significant hit