close all open/close all

CDS information : Stref_00280


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction28,239 / 29,417 / + [in whole cluster]
28,239 / 29,417 / + [in contig]
Location28239..29417 [in whole cluster]
28239..29417 [in contig]
TypeCDS
Length1,179 bp (392 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)O-methyl transferase
Gene
Gene (GenBank)stfMIII
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q83WF2
PmId
[19415708] Functional analysis of MycE and MycF, two O-methyltransferases involved in the biosynthesis of mycinamicin macrolide antibiotics. (Chembiochem. , 2009)
ACC
O54261
NITE
Nogl_00410
PmId
[22120896] Identification of late-stage glycosylation steps in the biosynthetic pathway of the anthracycline nogalamycin. (Chembiochem. , 2012)
ACC
Q2P9Z1
NITE
Stref_00240
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative O-methyltransferase [O-methyl transferase]
MEPVMDDRRLAELITLADRPPGDTDAGIAGLGPAAVAEALLGEICSRARLLPDLPEKVAV
QFDLGYGAERLRYLLTLGPGRWEAEPGDDPLAPVTYRQDLAELLRAVFSPGPHDGTRELS
VKDSEEPHGIAADDPWLRQRRLAVLAAHQATEAISGRFTDLTALAVRFDADKWGGHWYTP
HYQQYFEPLRDRRVRVLEIGVGGYDAPDLGGASLRMWKHYFWRGQIYGLDLYPKHGVTEP
RLRTLQGDQGDAAFLTDIATEYGPFDVVIDDGSHFSQDVRTSFASLFPHVRHGGLYVIED
MQSSYWPGWGGSTDLNASATSMGFVKTLLDGLNHQEQIRTADQRPSATELSVRGVHVHHN
LAVIEKGVNTEQGTPAWVPRTEDPRAWYPSQS
selected fasta
>putative O-methyltransferase [O-methyl transferase]
ATGGAACCGGTCATGGACGACCGTCGGTTGGCCGAGCTGATCACACTGGCCGACCGTCCT
CCCGGCGACACCGACGCCGGGATCGCCGGGCTCGGACCCGCGGCGGTCGCCGAGGCACTG
CTCGGGGAGATCTGCTCACGGGCCCGGCTGCTCCCCGACCTCCCGGAGAAGGTGGCCGTA
CAGTTCGACCTCGGGTACGGCGCGGAGCGACTGCGCTATCTGCTCACCCTGGGCCCGGGC
AGGTGGGAGGCGGAGCCGGGTGACGACCCGCTGGCTCCGGTGACGTACCGCCAGGACCTG
GCGGAGCTGCTGCGCGCGGTGTTCTCCCCCGGCCCCCACGACGGCACCCGTGAGCTGTCC
GTCAAGGACTCCGAGGAGCCGCACGGCATCGCCGCCGACGATCCGTGGCTCCGGCAGCGG
CGGCTCGCCGTGCTGGCCGCGCACCAGGCCACGGAAGCGATCTCCGGGCGGTTCACCGAT
CTCACCGCCCTCGCCGTGCGGTTCGACGCGGACAAGTGGGGAGGGCACTGGTACACCCCG
CACTATCAGCAGTACTTCGAACCGCTGCGGGACCGCCGGGTGCGGGTCCTGGAGATCGGC
GTCGGCGGCTACGACGCCCCGGATCTCGGCGGCGCGTCACTGCGCATGTGGAAGCACTAC
TTCTGGCGGGGCCAGATCTACGGGCTCGATCTCTACCCCAAGCACGGCGTCACCGAGCCC
CGGCTCCGGACCCTTCAGGGCGACCAGGGCGATGCCGCGTTCCTCACGGACATCGCTACG
GAGTACGGCCCGTTCGACGTGGTGATCGACGACGGCAGCCACTTCAGCCAGGACGTCCGC
ACGTCGTTCGCCTCGCTCTTCCCGCACGTGCGCCACGGGGGGCTCTACGTCATCGAGGAC
ATGCAGTCCAGCTACTGGCCGGGCTGGGGCGGGAGTACCGACCTCAACGCGTCCGCCACC
TCGATGGGGTTCGTCAAGACCCTGCTCGACGGGCTCAACCACCAGGAGCAGATCCGCACG
GCGGACCAGCGGCCCTCGGCGACCGAGCTGTCGGTGCGGGGGGTGCATGTGCACCACAAC
CTGGCCGTGATCGAGAAGGGCGTCAACACCGAGCAGGGCACACCGGCGTGGGTCCCGCGC
ACCGAGGACCCACGGGCCTGGTACCCGTCCCAGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit