close all open/close all

CDS information : Stref_00300


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction34,971 / 33,847 / - [in whole cluster]
34,971 / 33,847 / - [in contig]
Locationcomplement(33847..34971) [in whole cluster]
complement(33847..34971) [in contig]
TypeCDS
Length1,125 bp (374 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in steffimycin biosynthesis.
Note (GenBank)
  • ORF30
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPALIDERSFNLDDERAKNLLKALVTVYSTKPAARQVILGAGLGEGDINWGQSMADVWPE
ALELAAPAGRLRALVQLAANDPNTRGHPVFHYLLTEETSAAETDPCTAYLVANRQRAFFN
RLKFRTTLHHMVEGAGGRVLAVEGERQTGRTHSWYLIAHVLDSHRVNRRRIRMRDFYSPV
EVADIGVTLRELFGWNITLDLNTSEDSQSRSLVNQIKHLLNEEHRTGQVLTGHWLVIDDS
QSVRFTEPALRALIRLVAAVIEEEMADRLRIVLLAYDGWLPSDLESYVAHEHFAPLTGKD
LHDYVRAVAKEAGSPVDSEQADQLVNELSSLSGCGPVTADAPLPMSDRLQLVAASWGRDQ
YDRGGARCDQRSER
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCCGCGTTGATCGACGAGCGCTCCTTCAACCTCGACGACGAACGAGCCAAGAACCTG
CTCAAGGCCCTGGTCACCGTCTACAGCACCAAACCCGCCGCGCGGCAGGTCATTCTCGGC
GCCGGACTGGGTGAGGGCGATATCAACTGGGGTCAGAGCATGGCCGACGTCTGGCCGGAG
GCTCTTGAACTCGCGGCCCCGGCCGGTCGTCTGCGGGCCCTCGTCCAGTTGGCCGCGAAC
GACCCCAACACCCGGGGCCATCCGGTCTTTCACTACCTTCTGACGGAGGAGACGTCCGCC
GCCGAAACGGACCCGTGCACCGCGTATCTGGTGGCCAACCGCCAAAGGGCATTCTTCAAC
CGCCTGAAGTTCCGGACCACGCTGCACCACATGGTGGAAGGGGCTGGCGGACGTGTCCTC
GCCGTGGAGGGAGAGCGTCAGACAGGCAGGACACACAGCTGGTACCTCATCGCCCATGTA
CTGGACAGCCATCGCGTCAACAGGCGACGCATCAGGATGCGCGACTTCTACTCACCGGTG
GAGGTCGCCGACATAGGCGTCACCCTGAGGGAACTCTTCGGGTGGAACATCACGCTCGAT
CTCAACACCTCGGAGGACAGCCAGTCCCGCAGTCTGGTCAACCAGATCAAGCACCTGCTG
AACGAGGAACACCGGACGGGGCAGGTGCTGACCGGGCACTGGCTCGTCATCGACGACTCT
CAGTCCGTGCGCTTCACCGAGCCCGCCCTGAGAGCGTTGATCCGGCTGGTGGCCGCCGTG
ATCGAGGAGGAGATGGCGGACCGGCTCCGCATCGTCCTGCTCGCCTACGACGGCTGGCTC
CCCTCCGACCTGGAGTCCTACGTCGCCCACGAGCACTTCGCCCCGCTCACCGGCAAGGAC
CTGCATGACTACGTCCGGGCCGTCGCCAAGGAAGCAGGCAGTCCCGTCGACTCCGAACAG
GCCGACCAGCTCGTCAACGAACTGAGCAGCCTGTCCGGCTGCGGCCCCGTCACCGCCGAC
GCTCCGCTGCCGATGTCCGACCGGCTGCAACTCGTCGCCGCGTCATGGGGCCGTGACCAG
TACGACAGGGGAGGTGCCCGTTGTGACCAGCGCTCCGAACGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit