close all open/close all

CDS information : Stref_00310


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction36,010 / 34,976 / - [in whole cluster]
36,010 / 34,976 / - [in contig]
Locationcomplement(34976..36010) [in whole cluster]
complement(34976..36010) [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative trypsin-like serine protease
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in steffimycin biosynthesis.
Note (GenBank)
  • ORF31
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [putative trypsin-like serine protease]
MTHFVDRVPFQWDAPGALELRDLLAGVYTRSAPAEQLAKRAGVATGYINWEQPMMTVWFE
LMEKAANQKCLRPLLEAVTEGPDQAVADRVRELLAAQPVVEAPDRPTGPQDFAEFDDPDQ
LERQIFRSHTLQDVAFLRRGTELATSVCRLRVTAADGSQYHGTAFRITDDLLLTNHHVLF
DGNGSAPLGVEAWFGYEAELNGRTREHQVVLCDVESAVGEPELDWAVVRSAEPLPGDALR
VALPSAVHVSLNDRVYIIQHPHGGVKKLAARHNVVRHVDDTVVQYWTDTEQGSSGSPVFD
ERWNLVALHRRWLRVGADDEPAEFRNEGVRIERVLDGLARKRLV
selected fasta
>hypothetical protein [putative trypsin-like serine protease]
ATGACGCACTTCGTGGACCGAGTTCCCTTCCAGTGGGATGCGCCCGGCGCCCTGGAACTG
CGTGATCTGCTGGCCGGGGTGTACACCCGATCCGCCCCGGCCGAGCAACTGGCGAAGCGG
GCCGGTGTGGCGACGGGATACATCAACTGGGAACAGCCCATGATGACCGTCTGGTTCGAA
CTCATGGAGAAAGCGGCCAACCAGAAGTGTCTGCGCCCCCTTTTGGAGGCGGTCACCGAG
GGGCCTGACCAGGCTGTCGCCGACCGGGTCCGTGAACTCCTCGCCGCGCAGCCTGTCGTG
GAGGCACCGGACAGGCCCACGGGGCCGCAAGATTTCGCGGAGTTCGACGATCCCGACCAA
CTGGAGCGGCAGATCTTCCGCTCCCACACGCTCCAGGACGTGGCCTTCCTGCGCCGGGGA
ACCGAACTGGCCACTTCCGTGTGCCGGTTGCGCGTCACAGCCGCCGACGGCAGTCAATAC
CACGGCACGGCCTTCCGTATCACGGACGATCTTCTACTGACCAATCACCATGTGCTGTTC
GACGGCAACGGAAGCGCACCGCTCGGGGTCGAGGCGTGGTTCGGTTACGAGGCCGAGCTG
AACGGGCGGACGCGCGAGCATCAAGTGGTGCTCTGTGACGTGGAGTCGGCTGTGGGAGAG
CCCGAGCTGGACTGGGCGGTCGTCCGGAGCGCCGAGCCGCTGCCCGGTGACGCCCTTCGT
GTCGCCCTGCCCAGCGCTGTCCACGTGTCCCTGAACGACAGGGTGTACATCATCCAGCAC
CCGCACGGCGGGGTGAAGAAGCTCGCCGCCCGCCACAATGTCGTACGCCATGTCGACGAC
ACTGTGGTGCAGTACTGGACCGACACGGAACAGGGATCGTCCGGGTCGCCCGTCTTCGAC
GAGCGGTGGAACCTCGTCGCCTTGCACCGCCGCTGGCTCAGGGTCGGCGCCGACGACGAG
CCCGCCGAGTTCCGTAACGAAGGTGTGAGGATCGAGCGGGTTCTGGATGGACTCGCACGG
AAGCGACTGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008256 Peptidase S1B, glutamyl endopeptidase I (Domain)
 [162-179]  1.30000067202732e-06 PR00839 [283-299]  1.30000067202732e-06 PR00839
PR00839   V8PROTEASE
IPR009003 Peptidase cysteine/serine, trypsin-like (Domain)
 [146-339]  4.40000933643891e-28 SSF50494
SSF50494   Pept_Ser_Cys
SignalP No significant hit
TMHMM No significant hit