close all open/close all

CDS information : Stref_00330


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction39,223 / 37,796 / - [in whole cluster]
39,223 / 37,796 / - [in contig]
Locationcomplement(37796..39223) [in whole cluster]
complement(37796..39223) [in contig]
TypeCDS
Length1,428 bp (475 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical Sun-family protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in steffimycin biosynthesis.
Note (GenBank)
  • ORF33
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical Sun-family protein]
MSDQPRRPRSSGKPYRRPKKDPVRILAFEALRAVDERDAYANLVLPPLLRKAREKEGPEK
FDARDAALATELVYGTLRWQGTYDAVLASCVDRPLGDVDPPVLDVLSLGAHQLLGTRIPT
HAAVSATVELARVVLGDGRAKFVNAVLRKVAQHDLDGWLERVAPPYDEDPEDHLAVVHSH
PRWVVSALWDSLGGGRDGIEELLRADNERPEVTLVARPGRATAEELLGEDAAVPGRWSPY
AVRLAEGGEPGAVEAVRDGRAGVQDEGSQLVAIALAGAPLDGPDRRWLDGCAGPGGKAAL
LGALAAERGALLVASEKQTHRAGLVARALEGNPGPYQVIAADGTRPAWRPGSFDRVLVDV
PCTGLGALRRRPEARWRRRPDDLEGFAPLQRGLLRTALESVRVGGVVGYATCSPHLAETR
AVVADVLKQYPDTELVDARPLLPGVPDLGEGPDVQLWPHRHGTDAMYLALIRRTG
selected fasta
>hypothetical protein [hypothetical Sun-family protein]
GTGAGCGACCAGCCCCGTCGGCCCCGTTCGTCCGGCAAGCCCTACCGTCGGCCCAAGAAG
GACCCCGTCCGCATCCTGGCGTTCGAGGCGCTGAGGGCCGTGGACGAGCGGGACGCCTAC
GCCAACCTCGTTCTGCCGCCCCTGCTGCGCAAGGCGCGGGAGAAGGAGGGCCCCGAGAAG
TTCGACGCCCGGGACGCGGCGCTCGCCACCGAGCTGGTGTACGGGACGCTGCGGTGGCAG
GGGACGTACGACGCGGTGCTGGCGAGCTGCGTGGACCGGCCGCTCGGGGACGTCGACCCG
CCGGTGCTGGACGTGCTGAGCCTGGGTGCGCACCAGTTGCTCGGGACGCGGATCCCGACC
CACGCCGCCGTGTCCGCCACGGTCGAGCTCGCGCGGGTCGTGCTCGGCGACGGGCGGGCC
AAGTTCGTCAACGCCGTGCTGCGGAAGGTCGCGCAGCACGATCTGGACGGCTGGCTGGAG
CGCGTGGCGCCGCCCTACGACGAGGATCCCGAGGACCATCTCGCCGTCGTCCACTCGCAT
CCCAGGTGGGTCGTGTCCGCGCTGTGGGACTCCCTCGGCGGCGGGCGCGACGGCATCGAG
GAACTGCTGCGCGCCGACAACGAGCGCCCCGAGGTGACGCTGGTGGCGCGGCCGGGGCGG
GCGACCGCCGAGGAACTGCTCGGCGAGGACGCCGCCGTGCCCGGACGCTGGTCCCCGTAC
GCCGTGCGGCTGGCCGAGGGCGGTGAGCCCGGTGCTGTCGAAGCCGTACGGGACGGACGC
GCGGGCGTGCAGGACGAGGGCAGCCAGCTCGTGGCGATCGCCCTGGCGGGCGCGCCCCTG
GACGGGCCCGACCGGCGCTGGCTGGACGGGTGCGCGGGGCCCGGCGGCAAGGCCGCGCTG
CTCGGGGCCCTGGCCGCCGAGCGCGGGGCTCTGCTGGTGGCCTCCGAGAAGCAGACCCAC
CGTGCCGGGCTGGTGGCGAGGGCGCTGGAGGGCAATCCGGGGCCGTATCAGGTGATCGCC
GCCGACGGGACCCGCCCGGCGTGGCGGCCCGGCAGCTTCGACCGGGTGCTGGTCGACGTG
CCCTGCACCGGACTCGGCGCCCTGCGGCGTCGCCCCGAGGCACGCTGGCGGCGCCGGCCG
GACGACCTGGAGGGGTTCGCGCCGTTGCAGCGCGGGCTGCTGCGCACCGCGCTGGAGTCG
GTGCGGGTCGGCGGTGTCGTCGGTTACGCGACCTGCTCGCCGCACCTCGCCGAGACCAGG
GCCGTGGTCGCCGACGTGCTCAAGCAGTACCCGGACACCGAGCTCGTCGACGCCCGGCCG
CTGCTGCCCGGCGTACCGGATCTGGGCGAGGGGCCGGACGTCCAGCTGTGGCCGCATCGG
CACGGGACCGACGCCATGTATCTGGCGCTCATCCGCCGGACCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001678 Bacterial Fmu (Sun)/eukaryotic nucleolar NOL1/Nop2p (Domain)
 [206-472]  1.29999999999998e-45 PF01189
PF01189   Nol1_Nop2_Fmu
IPR006027 NusB/RsmB/TIM44 (Domain)
 [20-185]  1.99999999999999e-45 G3DSA:1.10.940.10
G3DSA:1.10.940.10   NusB_RsmB_TIM44
 [23-151]  7.29999999999998e-25 PF01029
PF01029   NusB
 [21-184]  5.8999880940569e-38 SSF48013
SSF48013   NusB_RsmB_TIM44
IPR018314 Bacterial Fmu (Sun)/eukaryotic nucleolar NOL1/Nop2p, conserved site (Conserved_site)
 [353-364]  PS01153
PS01153   NOL1_NOP2_SUN
IPR023267 RNA (C5-cytosine) methyltransferase (Family)
 [255-269]  3.1999989904635e-20 PR02008 [288-298]  3.1999989904635e-20 PR02008 [354-366]  3.1999989904635e-20 PR02008 [404-420]  3.1999989904635e-20 PR02008 [456-473]  3.1999989904635e-20 PR02008
PR02008   RCMTFAMILY
SignalP No significant hit
TMHMM No significant hit