close all open/close all

CDS information : Stref_00340


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction40,605 / 39,673 / - [in whole cluster]
40,605 / 39,673 / - [in contig]
Locationcomplement(39673..40605) [in whole cluster]
complement(39673..40605) [in contig]
TypeCDS
Length933 bp (310 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.2 translation
Productputative methionyl-tRNA formyltransferase
Product (GenBank)putative methionyl-tRNA formyltransferase
Genefmt
Gene (GenBank)
EC number2.1.2.9
Keyword
Note
  • This ORF is not involved in steffimycin biosynthesis.
Note (GenBank)
  • ORF34
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
P23882
PmId
[1624424] Disruption of the gene for Met-tRNA(fMet) formyltransferase severely impairs growth of Escherichia coli. (J Bacteriol. , 1992)
[8432722] The Escherichia coli fmt gene, encoding methionyl-tRNA(fMet) formyltransferase, escapes metabolic control. (J Bacteriol. , 1993)
[8887566] Structure of crystalline Escherichia coli methionyl-tRNA(f)Met formyltransferase: comparison with glycinamide ribonucleotide formyltransferase. (EMBO J. , 1996)
[9843487] Crystal structure of methionyl-tRNAfMet transformylase complexed with the initiator formyl-methionyl-tRNAfMet. (EMBO J. , 1998)

close this sectionSequence

selected fasta
>putative methionyl-tRNA formyltransferase [putative methionyl-tRNA formyltransferase]
MKLVFAGTPEVAVPALDALLASGRHEVAAVVTRPDAPAGRGRRLVASPVAERAEEAGIEV
LKPAKPKDPEFLERLREIGPDCCPVVAYGALLPRVALDVPAHGWVNLHFSLLPAWRGAAP
VQHAIMAGDQITGASTFLIEEGLDSGPVYGTVTEEIRATDTSGDLLTRLAFAGAGLLAAT
MDGIEDGTLKAVPQPAEGVSLAPKVNVEDAHVDWNAPALRVDRLVRGCTPAPGAWTTFRG
ERLKLIQVAAVPDRTDLAPGQIAAQKNNVYVGTGSYGVELLWVQAQGKKPMRAADWARGV
RIAEEERLGG
selected fasta
>putative methionyl-tRNA formyltransferase [putative methionyl-tRNA formyltransferase]
ATGAAGCTCGTCTTCGCCGGTACACCCGAGGTCGCCGTTCCCGCTCTGGACGCCCTTCTC
GCCTCCGGGCGGCACGAGGTGGCCGCCGTCGTCACGCGGCCCGACGCGCCGGCCGGGCGG
GGGCGCAGGCTCGTCGCGTCGCCCGTCGCCGAGCGTGCGGAGGAGGCGGGGATCGAGGTG
CTGAAGCCCGCGAAGCCGAAGGACCCCGAGTTCCTGGAGCGGCTGCGCGAGATCGGGCCG
GACTGCTGTCCCGTCGTCGCCTACGGTGCGCTGCTGCCCAGGGTCGCTCTCGACGTCCCC
GCGCACGGCTGGGTCAATCTGCACTTCTCCCTGCTGCCGGCCTGGCGGGGTGCCGCGCCC
GTGCAGCACGCCATCATGGCGGGCGACCAGATCACCGGGGCGTCGACCTTCCTGATCGAG
GAGGGGCTCGACTCGGGGCCGGTGTACGGGACGGTGACCGAGGAGATCCGGGCCACCGAC
ACCAGCGGGGATCTGCTGACGCGGCTCGCGTTCGCCGGTGCCGGGCTGCTCGCGGCCACC
ATGGACGGGATCGAGGACGGCACCCTGAAGGCCGTACCGCAGCCCGCCGAGGGGGTCAGC
CTGGCCCCGAAGGTCAACGTCGAGGACGCCCACGTCGACTGGAACGCGCCCGCGCTGCGC
GTCGACCGGTTGGTGCGGGGCTGCACTCCGGCACCGGGCGCCTGGACCACGTTCCGCGGT
GAGCGGCTCAAGCTCATCCAGGTCGCCGCCGTGCCGGACCGCACGGATCTCGCGCCGGGG
CAGATCGCCGCCCAGAAGAACAACGTGTACGTCGGCACCGGCTCGTACGGCGTCGAACTG
CTGTGGGTGCAGGCCCAGGGCAAGAAGCCGATGCGGGCGGCGGACTGGGCACGAGGCGTG
CGGATCGCCGAGGAGGAGCGGCTCGGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002376 Formyl transferase, N-terminal (Domain)
 [1-174]  1.8e-31 PF00551
PF00551   Formyl_trans_N
 [1-207]  5.8999880940569e-62 SSF53328
SSF53328   formyl_transf
 [1-205]  9.9e-61 G3DSA:3.40.50.170
G3DSA:3.40.50.170   Formyl_transf_N
IPR005793 Formyl transferase, C-terminal (Domain)
 [205-300]  9e-25 PF02911
PF02911   Formyl_trans_C
 [208-309]  1.4e-31 G3DSA:3.10.25.10
G3DSA:3.10.25.10   Formyl_trans_C
IPR005794 Methionyl-tRNA formyltransferase (Family)
 [1-301]  1.39999999999997e-69 TIGR00460
TIGR00460   Fmt
IPR011034 Formyl transferase, C-terminal-like (Domain)
 [208-308]  7.00000734129907e-29 SSF50486
SSF50486   FMT_C_like
SignalP
 [1-29]  0.207 Signal
Eukaryota   
TMHMM No significant hit