close all open/close all

CDS information : Stref_00350


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction40,935 / 41,486 / + [in whole cluster]
40,935 / 41,486 / + [in contig]
Location40935..41486 [in whole cluster]
40935..41486 [in contig]
TypeCDS
Length552 bp (183 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in steffimycin biosynthesis.
Note (GenBank)
  • ORF35
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MADHATHDAQARASLHLLVRDIERVRRQVDALRTLTAQLGNVYRPRRSGPSTGFVVYGRA
PAPTVRLAQELRDSVETLVTAAVDFDRSLGFSWDAVGSALGVTKQAVHRRYGARRATAQS
AAAAAEAERTAEASGSRTVHVNTGLPAVPTVPAARSMPTQPTAGSPALRDEARPTALPSP
RNG
selected fasta
>hypothetical protein [hypothetical protein]
ATGGCCGACCACGCAACCCACGACGCCCAGGCTCGGGCCAGCCTGCACTTGCTGGTGCGG
GACATCGAGCGGGTCCGCCGGCAGGTGGACGCACTGCGCACGCTCACCGCCCAGCTGGGC
AACGTCTACCGCCCGCGCCGCTCCGGCCCCTCCACGGGCTTCGTCGTCTACGGACGCGCC
CCCGCCCCGACGGTACGTCTCGCGCAGGAACTGCGGGACAGCGTCGAGACCCTGGTCACG
GCAGCCGTGGACTTCGACCGCTCACTCGGCTTCTCGTGGGACGCCGTGGGCTCCGCCCTG
GGAGTCACCAAGCAGGCGGTCCACCGCCGTTACGGCGCACGCCGTGCCACGGCCCAGTCG
GCCGCAGCCGCGGCCGAGGCGGAGCGCACCGCGGAAGCGTCGGGCAGCCGCACGGTCCAT
GTGAACACCGGTCTGCCCGCCGTACCCACGGTCCCCGCGGCCCGCTCCATGCCCACCCAG
CCGACAGCAGGCAGCCCGGCCCTCCGCGACGAGGCGAGGCCGACGGCCCTGCCGAGCCCG
CGCAACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit