close all open/close all
Stref_00350 Stref_00350   last last

CDS information : Stref_00360


close this sectionLocation

Organism
StrainNRRL 3193 (=NBRC 13446)
Entry nameSteffimycin
Contig
Start / Stop / Direction42,876 / 41,608 / - [in whole cluster]
42,876 / 41,608 / - [in contig]
Locationcomplement(41608..42876) [in whole cluster]
complement(41608..42876) [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative primosomal protein N'
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in steffimycin biosynthesis.
Note (GenBank)
  • ORF36
Reference
ACC
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>[putative primosomal protein N']
MGTRAAMFAPVQDLGLVALWDDGDDSHSEQHAPQPHAREVLLLRAAQDKCGFLLGSWGCT
VEAAQLVETGWARPLVATRERVRATAPLVRTVGDGDLARDEAARAARLPTLAWQAVRDGL
AVGPVLVQVPRRGYVPRMACAVCRAPARCPHCSGPLQARDGGALDCGWCGREEAGWHCPE
CGSFRLRASVVGARRTAEELGRAFPTVPVRTSGREHVLDTVPGAPALVVSTPGAEPVAEG
GYAAALLLDGWAMLGRPDLRAGEDALRRWIAAGALVRPQSDGGTVVVVAEPTLRPVQALV
RWDPVGHAVRELAERAELGFPPVSRMAAVSGPPEAVADFLRTAELPPEAEVLGPVPLPVP
AAGRPRRAGAPPPGEQWERALLRVPPGRGAALAAALKAAQAARMARGSGSAVWVRIDPVD
IG
selected fasta
>[putative primosomal protein N']
ATCGGCACCCGGGCGGCGATGTTCGCGCCGGTCCAGGACCTGGGACTCGTCGCCCTGTGG
GACGACGGCGACGACAGCCACAGCGAGCAGCACGCCCCGCAGCCGCACGCCCGGGAGGTG
CTGCTGCTGCGGGCCGCCCAGGACAAGTGCGGCTTCCTGCTGGGCAGCTGGGGCTGCACG
GTGGAGGCCGCGCAACTCGTCGAGACCGGGTGGGCGCGGCCGCTGGTCGCCACGCGGGAG
CGGGTACGCGCCACCGCACCGCTCGTACGGACCGTCGGTGACGGGGACCTCGCGCGGGAC
GAGGCGGCCCGGGCCGCCCGGCTGCCGACGCTCGCCTGGCAGGCCGTCAGGGACGGTCTG
GCCGTGGGCCCGGTGCTGGTGCAGGTGCCCCGGCGGGGCTACGTGCCGCGCATGGCGTGC
GCCGTCTGCCGGGCGCCCGCGCGGTGCCCGCACTGCTCCGGGCCGCTCCAGGCGCGGGAC
GGCGGTGCCCTGGACTGCGGGTGGTGCGGCCGCGAGGAGGCCGGCTGGCACTGCCCCGAG
TGCGGTTCCTTCCGGCTGCGCGCCTCGGTGGTGGGTGCGCGGCGGACCGCCGAGGAACTC
GGGCGGGCCTTCCCCACGGTTCCCGTGCGGACGTCCGGCCGTGAACACGTGCTCGACACG
GTGCCGGGGGCGCCCGCGCTGGTGGTCAGTACGCCGGGGGCCGAGCCCGTCGCCGAGGGC
GGGTACGCGGCGGCGCTGCTGCTCGACGGGTGGGCCATGCTCGGGCGGCCGGATCTGCGG
GCCGGCGAGGACGCGTTGCGGCGGTGGATCGCGGCCGGGGCACTCGTCCGGCCGCAGTCG
GACGGGGGCACGGTGGTGGTCGTGGCCGAGCCGACGCTGCGGCCCGTGCAGGCGCTGGTG
CGGTGGGACCCCGTGGGGCACGCGGTGCGCGAGCTGGCCGAGCGCGCCGAGCTGGGATTT
CCGCCGGTGTCGCGGATGGCGGCCGTGTCGGGGCCGCCGGAAGCGGTGGCCGACTTCCTC
CGTACGGCCGAACTGCCGCCGGAGGCCGAGGTGCTGGGGCCGGTGCCGTTGCCCGTCCCC
GCCGCGGGGCGACCGCGGCGGGCGGGAGCACCGCCGCCCGGGGAGCAGTGGGAGCGGGCG
CTGCTGCGGGTGCCGCCTGGGAGGGGTGCCGCGCTGGCCGCCGCGCTGAAGGCGGCGCAG
GCGGCGCGAATGGCTCGGGGGAGTGGGAGCGCGGTGTGGGTGCGGATCGACCCCGTGGAC
ATCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit
Stref_00350 Stref_00350   last last