close all open/close all
first first   Strply_00020 Strply_00020

CDS information : Strply_00010


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction1 / 438 / + [in whole cluster]
1 / 438 / + [in contig]
Location1..438 [in whole cluster]
1..438 [in contig]
TypeCDS
Length438 bp (145 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glycerophosphodiester phosphodiesterase(fragment)
Product (GenBank)putative glycerophosphoryl diester phosphodiesterase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in streptolydigin biosynthesis.
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Family/Domain
FD
IPR004129

close this sectionSequence

selected fasta
>putative glycerophosphodiester phosphodiesterase(fragment) [putative glycerophosphoryl diester phosphodiesterase]
GSVFEQVVEAVKAPLQAEIKDVAAAQALAEVMRARDLVGRVEVISFHDEALAAIRTLLPG
VRTALVASRYGADVVDRAQAVGATMLSLNIRRLTLELVERAHAAHLKVVAWTVNTHDQLR
LARGLGLDGVVTDLPEIRRAVRFTA
selected fasta
>putative glycerophosphodiester phosphodiesterase(fragment) [putative glycerophosphoryl diester phosphodiesterase]
GGATCCGTCTTCGAGCAGGTGGTGGAGGCGGTCAAGGCGCCGCTCCAGGCCGAGATCAAG
GACGTGGCGGCCGCGCAGGCGCTGGCCGAGGTGATGCGGGCGCGCGATCTGGTCGGCCGG
GTCGAGGTGATCTCCTTCCACGACGAGGCGCTGGCGGCGATCCGCACCCTGCTGCCGGGG
GTGCGCACCGCGCTGGTGGCCAGTCGCTACGGCGCCGATGTGGTGGACCGCGCCCAGGCC
GTGGGCGCGACGATGCTCTCGCTGAACATCCGGCGGCTCACCCTGGAACTGGTCGAGCGG
GCGCACGCCGCCCATCTGAAGGTCGTCGCCTGGACGGTCAACACCCACGACCAGCTGCGA
CTGGCGCGCGGCCTGGGGCTGGACGGTGTGGTGACCGACCTCCCGGAGATCCGGCGGGCG
GTGCGCTTCACCGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004129 Glycerophosphoryl diester phosphodiesterase (Family)
 [39-136]  1.3e-10 PF03009
PF03009   GDPD
IPR017946 PLC-like phosphodiesterase, TIM beta/alpha-barrel domain (Domain)
 [4-142]  1.29999924468179e-22 SSF51695
SSF51695   PLC-like_Pdiesterase_TIM-brl
 [4-140]  2.4e-26 G3DSA:3.20.20.190
G3DSA:3.20.20.190   PLC-like_Pdiesterase_TIM-brl
SignalP
 [1-24]  0.138 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
first first   Strply_00020 Strply_00020