close all open/close all

CDS information : Strply_00020


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction808 / 1,194 / + [in whole cluster]
808 / 1,194 / + [in contig]
Location808..1194 [in whole cluster]
808..1194 [in contig]
TypeCDS
Length387 bp (128 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in streptolydigin biosynthesis.
Note (GenBank)
  • ORF2
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MVHVLSSRVLLRPSDPERSRAFYGEALGLEIYREFGTGPERGTVYFLGGGFLEVSGRAAQ
PATDTLKLWLQVADAAAAHQELLAHGVEVLRPPVQEPWGLIEMWIADPDGHRIVLTQVPA
DHPLRYRP
selected fasta
>hypothetical protein [hypothetical protein]
ATGGTGCACGTACTGAGCAGCCGAGTGCTGTTGCGGCCGTCCGATCCCGAGCGCTCGCGG
GCGTTCTACGGCGAGGCGCTGGGGCTGGAGATCTACCGGGAGTTCGGCACCGGGCCCGAG
CGCGGCACGGTGTACTTCCTCGGCGGCGGCTTCCTGGAGGTCTCCGGCCGCGCCGCGCAG
CCCGCCACCGACACCCTCAAGCTGTGGCTCCAGGTGGCGGACGCGGCGGCGGCGCACCAG
GAGCTGCTGGCACACGGGGTCGAGGTGCTGCGGCCGCCCGTCCAGGAGCCGTGGGGCCTG
ATCGAGATGTGGATCGCCGATCCGGACGGCCACCGGATCGTGCTGACCCAGGTCCCGGCG
GACCATCCGCTGCGCTACCGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025870 Glyoxalase-like domain (Domain)
 [14-115]  7.4e-20 PF12681
PF12681   Glyoxalase_2
SignalP
 [1-21]  0.286 Signal
Bacteria, Gram-positive   
 [1-21]  0.164 Signal
Eukaryota   
TMHMM No significant hit