close all open/close all

CDS information : Strply_00030


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction1,429 / 4,260 / + [in whole cluster]
1,429 / 4,260 / + [in contig]
Location1429..4260 [in whole cluster]
1429..4260 [in contig]
TypeCDS
Length2,832 bp (943 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional regulator
Product (GenBank)LuxR-family transcriptional regulator
Gene
Gene (GenBank)slgR2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[22820841] Three pathway-specific regulators control streptolydigin biosynthesis inStreptomyces lydicus. (Microbiology. , 2012)
Related Reference
ACC
Q9S0N8
NITE
Aver_00010
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[19148632] Characterization of a regulatory gene, aveR, for the biosynthesis of avermectin in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2009)
[20012992] The pathway-specific regulator AveR from Streptomyces avermitilis positively regulates avermectin production while it negatively affects oligomycin biosynthesis. (Mol Genet Genomics. , 2010)

close this sectionSequence

selected fasta
>LuxR family transcriptional regulator [LuxR-family transcriptional regulator]
MTLVGRKEETTVLRRMFADVQCGRGGVIIVTGSAALGKTGMLHAAAEHALQSGARWLSAT
ACSSEQALPLGVMSQLLRSAPLDEPATRRAEQLLREGAVPAADGPDAAEGRSARIHQGLC
EVLLTLAAETPLVITVDDVHQADTASMRCLSHLTRRLRSARIMVVLSKQLEAEPDLTPYT
DMSREPHVGHLGLRPLTESDVAALLGRRFDDAAARRLAPAVLAVSGGNPLLATVLADATG
SARAGRTGRAAVPAEPVVDEMFRQAVLTCLRRGDAKTGRVARALAVLDDAWSFDVLCRAL
DIDTLCAERAVRILEAAGLLVAGRFRHPAMRSAILDGMPAEERTRLHRRCARLLHDTGGP
ALDIARQLIGAGGAPDPEAVPVLREAAEQALAGDDAATAIRCLELAHRAALDNRQHVAVI
ADLARAELRVNLPAATRHLRSLLAPARDPHQRSAGVLAVIRRHLLWSVEERQAVEALRAP
GPSGAGEDRQLAAERHLSRVWLGCTFPSLVKELPACPSESAPDGSTPATIALNPELLAAT
LLSTALRDEDGKDVVADAEHILQNSALSDHTFEMLAFAILALFHADRLDKAAVWCRSLQA
QAVARRAPTWQAVFAALQAQIALRQGELSAAEEHARAALRLIPRRIWGPFGFLASSAMAL
ACTAMGKDTEAADQLSGPLPETAFDSLYGLYHLHARGQHHFANNRLQAALGDFLACGELM
TDWGVDVPTLVPWRSAAAEVLIQLGDRARARELLDAQLARPRANGPRLRGTTLRLLAATV
ELQRRPALLTEAVEELQSAHNPYELARALADLGDAHRALGAAGRARMVSRQAWNAARHCQ
AEPLLRRLKPTGGAEEVDRPLRVQAGPADIASLSSAERRVATLATLGYTNREISRKLHIT
VSTVEQHLTRVYRKLNVRHRTEIPSDLDLVVDSRRVGAERPVG
selected fasta
>LuxR family transcriptional regulator [LuxR-family transcriptional regulator]
ATGACGTTAGTCGGTCGGAAAGAGGAAACGACGGTCCTGCGAAGGATGTTCGCGGACGTC
CAATGCGGCAGAGGCGGCGTCATCATCGTCACCGGCTCCGCCGCTCTGGGAAAAACCGGG
ATGCTGCACGCTGCGGCCGAGCACGCCCTGCAGTCCGGTGCCCGATGGCTCAGTGCCACG
GCCTGCTCCTCGGAGCAGGCCCTCCCGCTGGGCGTGATGAGCCAGCTGCTGCGGAGCGCG
CCGCTGGACGAGCCGGCGACCAGGCGGGCCGAACAACTCCTGAGAGAAGGCGCCGTGCCG
GCGGCGGACGGCCCGGACGCCGCGGAGGGCAGGTCCGCGCGCATCCACCAGGGACTGTGC
GAAGTACTGCTGACGCTCGCGGCGGAAACCCCCCTCGTCATCACGGTGGACGACGTCCAC
CAGGCGGACACGGCGTCCATGCGCTGTCTGTCCCACCTGACCCGGCGGCTTCGCTCGGCC
CGCATCATGGTCGTGCTGAGCAAGCAGCTGGAGGCCGAGCCCGACCTGACGCCGTACACC
GACATGTCCCGGGAACCGCACGTCGGACACCTGGGGCTGCGGCCGCTGACCGAGTCCGAT
GTCGCCGCACTGCTCGGCCGTCGCTTCGACGACGCCGCCGCGCGGCGGCTGGCTCCGGCG
GTGCTCGCGGTCTCCGGCGGCAATCCGCTGCTGGCGACCGTCCTGGCCGATGCCACCGGG
TCCGCCCGGGCGGGCCGTACGGGCCGGGCCGCGGTGCCCGCCGAGCCGGTGGTCGACGAG
ATGTTCCGCCAGGCGGTGCTGACCTGCCTGCGGCGCGGGGACGCCAAGACGGGCCGGGTC
GCCAGGGCCCTGGCCGTGCTGGACGACGCCTGGTCCTTCGACGTGCTGTGCCGCGCACTG
GACATCGACACGCTGTGCGCCGAGCGTGCCGTACGCATCCTGGAGGCGGCCGGGCTGCTG
GTCGCCGGGCGCTTCAGGCACCCCGCGATGCGGTCCGCGATCCTCGACGGCATGCCGGCC
GAGGAACGGACCCGGCTGCACCGGCGGTGCGCACGGCTGCTGCATGACACCGGGGGCCCG
GCGCTGGACATCGCCCGGCAGCTGATCGGCGCCGGCGGGGCGCCCGACCCCGAGGCGGTC
CCCGTCCTGCGCGAGGCGGCCGAGCAGGCGCTGGCCGGCGACGACGCGGCAACCGCCATC
CGGTGCCTGGAACTTGCCCACCGGGCGGCCCTGGACAACCGACAGCACGTCGCCGTCATC
GCGGACCTGGCCCGTGCCGAACTGCGGGTGAACCTCCCCGCCGCCACCCGCCACCTGCGG
TCCCTGCTGGCCCCGGCGCGGGACCCGCACCAGCGCTCCGCCGGTGTGCTGGCCGTGATC
CGGCGCCATCTGCTGTGGTCGGTCGAGGAGCGGCAGGCCGTCGAGGCGCTGCGGGCGCCG
GGTCCGTCCGGTGCCGGGGAGGACCGGCAGCTCGCGGCCGAGCGGCACCTCTCCCGGGTG
TGGCTGGGCTGCACCTTCCCGTCCCTGGTGAAGGAGTTACCGGCGTGCCCGTCGGAGTCG
GCGCCCGACGGCAGCACCCCGGCCACCATCGCCCTCAATCCGGAGCTCCTGGCGGCGACG
CTGCTGTCCACCGCGCTCCGGGACGAGGACGGCAAGGACGTGGTGGCGGACGCCGAGCAC
ATCCTGCAGAACTCCGCGCTCAGCGACCACACCTTCGAGATGCTGGCCTTCGCGATCCTG
GCGCTGTTCCACGCCGACCGGCTGGACAAGGCGGCGGTCTGGTGCCGGAGTCTCCAGGCA
CAGGCGGTCGCCCGCCGGGCCCCCACCTGGCAGGCGGTGTTCGCCGCGCTGCAGGCGCAG
ATCGCGCTGCGGCAGGGAGAGCTGTCGGCGGCCGAGGAGCACGCCCGCGCCGCGCTGCGG
CTGATCCCGCGGCGGATCTGGGGACCGTTCGGCTTCCTGGCCTCCAGCGCCATGGCGCTC
GCCTGCACCGCGATGGGCAAGGACACGGAAGCGGCGGACCAGCTGTCGGGCCCCCTGCCG
GAGACCGCCTTCGACTCGCTGTACGGCCTGTACCACCTGCACGCCCGCGGACAGCACCAC
TTCGCCAACAACCGTCTGCAGGCGGCCCTGGGCGACTTCCTGGCCTGCGGCGAGCTGATG
ACGGACTGGGGGGTGGACGTCCCCACGCTCGTACCGTGGCGCTCCGCGGCGGCGGAGGTC
CTGATCCAGCTCGGGGACCGGGCGCGGGCCCGCGAACTCCTCGACGCGCAGCTGGCCCGC
CCCCGCGCGAACGGCCCGCGCCTCCGGGGCACCACGCTCCGCCTGCTCGCCGCGACCGTC
GAACTCCAGCGGCGCCCGGCGCTGTTGACGGAGGCGGTGGAGGAGCTCCAGTCGGCGCAC
AATCCGTACGAACTGGCCCGGGCGCTGGCCGATCTCGGTGACGCGCACCGTGCGCTCGGT
GCCGCGGGGCGGGCGCGGATGGTGTCCCGGCAGGCGTGGAACGCCGCCCGGCACTGCCAG
GCCGAGCCGCTGCTGCGCCGGCTCAAACCGACCGGCGGTGCCGAGGAGGTTGACCGGCCG
CTGCGTGTCCAGGCCGGCCCCGCCGACATCGCCTCGCTGAGCAGCGCCGAGCGGAGGGTG
GCCACCCTCGCCACGCTCGGCTACACCAACCGCGAGATCAGCCGCAAGCTGCACATCACG
GTCAGCACGGTGGAGCAGCATCTGACGCGGGTGTACCGCAAGCTCAATGTGCGGCACCGC
ACGGAGATCCCCTCGGACCTGGACCTGGTGGTGGACAGCCGGCGGGTGGGGGCCGAACGG
CCGGTGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [866-934]  PS50043
PS50043   HTH_LUXR_2
 [873-887]  6.80000200614765e-08 PR00038 [887-903]  6.80000200614765e-08 PR00038 [903-915]  6.80000200614765e-08 PR00038
PR00038   HTHLUXR
 [887-914]  PS00622
PS00622   HTH_LUXR_1
 [870-927]  8.5999877623955e-20 SM00421
SM00421   HTH_LUXR
 [871-923]  1.7e-12 PF00196
PF00196   GerE
IPR011990 Tetratricopeptide-like helical (Domain)
 [538-675]  2e-11 G3DSA:1.25.40.10 [692-881]  2e-11 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [882-923]  2.1e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [851-923]  2.89999717862184e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit