close all open/close all

CDS information : Strply_00040


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction6,441 / 4,318 / - [in whole cluster]
6,441 / 4,318 / - [in contig]
Locationcomplement(4318..6441) [in whole cluster]
complement(4318..6441) [in contig]
TypeCDS
Length2,124 bp (707 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)non-ribosomal peptide synthetase
Gene
Gene (GenBank)slgN2
EC number
Keyword
  • 3-methylaspartate
Note
  • A domain seems to be imcomplete.
  • According to the reference, NRPS is composed of SlgN1, SlgN2 and SlgL.
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[22569159] Novel compounds produced by Streptomyces lydicus NRRL 2433 engineered mutants altered in the biosynthesis of streptolydigin. (J Antibiot (Tokyo). , 2012)
Related Reference
ACC
Q30CS3
NITE
Alip_00120
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)

close this sectionPKS/NRPS Module

8
C17..298
A497..552
PCP636..703

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase]
MSLSTGATARTASPKERSLWMLDRLVPDAGANNVPAALRIGGRLDRPALRTALTAVVRRH
DALRTVFHAADDTLTASVLAPGGTDLDVQEITPSADGPQAALTAFAATPFALDGRPLIRV
GLLADGDDDVLCFVVHHLVFDTVSAGVFTRSLARAYARVLRGEQPYPADEGAGPVPVLDE
PAPRPQSTDFWRDHLAGFDPGALETDCGTGHNPARPTLAGGRLDHTLTPGATAAVRKLAK
ELRAPEAVVLLAAYYLLLAAHGAGPDLVVGTPVNVRGDGAADAIGYHVNTLPLRTAVDPG
ESFRALVTRTRNVFFGALSHADAPVDALLAEVARPGASWRGSLFRHVFNYVPAPGDAGLA
FGDTPARTEPAESGYCKFDLELNVLATPETLSLRVVHGTEALAEADARALVRRYDALLSG
LGEAADRTVAEIEVGTDADRTALRTGYEEAVRAGGTAGFVASAGGREALPGVRGELCLVA
TSRPAADDGHDGAHPQHGPYRRTGELARRGYDGTLEILGRADRRVTVHGVPVQLDRLEAL
LASEDGVRAAAVVLRKGDDTDPGGLVAFLAAPDDPQLLDRLRKRIGAELPAAAEPGSFVV
LDALPTAADGRPDLAELERRAAAGGTTGADDADGQLLADLVELWNDVLERDDVGPQANFF
ELGGHSLLAAKVAQRSGKLAGVRVRLADVFANPTPLTLAEHLRAARA
selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase]
ATGTCACTCTCGACGGGGGCCACAGCGCGCACCGCCTCCCCCAAGGAACGGTCGCTGTGG
ATGCTCGACCGGCTCGTACCCGACGCGGGCGCCAACAACGTCCCGGCGGCCCTGCGGATC
GGCGGCCGGCTGGACCGCCCGGCCCTGCGGACGGCCCTGACCGCGGTGGTACGCCGCCAC
GACGCCCTGCGCACCGTCTTCCACGCCGCCGACGACACCCTCACCGCCTCGGTGCTCGCC
CCCGGCGGGACGGACCTGGACGTCCAGGAGATCACGCCCTCGGCGGACGGGCCGCAGGCC
GCCCTGACGGCCTTCGCCGCCACGCCGTTCGCCCTCGACGGCCGCCCGCTGATCCGCGTG
GGCCTCCTCGCCGACGGCGACGACGACGTGCTCTGCTTCGTCGTGCACCACCTGGTCTTC
GACACCGTCTCCGCGGGCGTCTTCACCCGCTCCCTGGCCCGGGCGTACGCACGGGTGCTG
CGCGGCGAGCAGCCGTACCCGGCCGACGAGGGCGCCGGCCCGGTCCCGGTGCTGGACGAA
CCCGCCCCTCGGCCGCAGAGCACCGACTTCTGGCGCGACCACCTGGCCGGCTTCGACCCC
GGCGCGCTGGAGACGGACTGCGGCACCGGCCACAACCCCGCCCGGCCCACGCTGGCCGGC
GGCAGGCTGGACCACACCCTCACGCCCGGGGCGACCGCGGCGGTGCGCAAGCTGGCCAAG
GAACTGCGCGCCCCCGAGGCCGTGGTGCTGCTCGCCGCCTACTACCTGCTGCTGGCCGCG
CACGGCGCCGGCCCCGACCTCGTCGTCGGCACGCCCGTCAACGTCCGCGGCGACGGCGCG
GCGGACGCCATCGGCTACCACGTCAACACCCTGCCGCTGCGGACGGCGGTGGACCCCGGC
GAGTCGTTCCGCGCGCTCGTCACCCGCACCCGGAACGTCTTCTTCGGCGCCCTGTCCCAT
GCGGACGCCCCCGTCGACGCCCTGCTCGCGGAGGTCGCCCGGCCCGGCGCGTCCTGGCGC
GGCTCGCTCTTCCGCCATGTGTTCAACTACGTCCCCGCCCCGGGCGACGCCGGCCTGGCC
TTCGGCGACACCCCGGCCCGCACGGAGCCCGCCGAGTCCGGGTACTGCAAGTTCGACCTG
GAACTGAACGTTCTCGCGACGCCGGAGACCCTCTCCCTGCGCGTGGTCCACGGCACCGAG
GCGCTCGCCGAGGCGGACGCCCGGGCGCTGGTACGGCGCTATGACGCCCTGCTGTCCGGC
CTGGGTGAGGCGGCGGACCGGACCGTGGCGGAGATCGAGGTGGGCACCGACGCCGACCGC
ACCGCGCTGCGGACCGGGTACGAGGAGGCGGTCCGCGCCGGGGGGACGGCCGGGTTCGTG
GCCTCCGCCGGCGGCCGGGAGGCGCTGCCCGGCGTGCGCGGCGAGCTGTGCCTCGTGGCC
ACGTCCCGCCCCGCGGCCGACGACGGGCACGACGGCGCACACCCGCAGCACGGGCCCTAC
CGCCGCACCGGCGAACTGGCCCGCCGCGGCTACGACGGCACGCTGGAGATCCTCGGCCGG
GCGGACCGCCGGGTCACCGTCCACGGCGTCCCGGTTCAACTCGACCGCCTGGAGGCCCTG
TTGGCCTCGGAGGACGGCGTGCGGGCGGCGGCCGTGGTGCTGCGGAAGGGCGACGACACC
GACCCCGGCGGACTGGTCGCCTTCCTCGCCGCCCCCGACGACCCGCAGCTCCTGGACCGG
CTGCGCAAGCGCATCGGCGCCGAACTGCCGGCCGCCGCCGAACCGGGCTCCTTCGTGGTC
CTGGACGCGCTGCCCACGGCCGCCGACGGGCGGCCGGACCTCGCGGAGCTGGAGCGCCGG
GCCGCCGCCGGAGGGACCACCGGCGCCGATGACGCCGACGGGCAGCTGCTGGCGGACCTG
GTCGAGCTGTGGAACGACGTCCTGGAACGGGACGACGTCGGCCCGCAGGCCAACTTCTTC
GAGCTGGGCGGCCATTCCCTGCTCGCCGCGAAGGTGGCACAGCGCAGCGGCAAGCTGGCC
GGCGTACGGGTCAGGCTCGCCGACGTCTTCGCCAACCCGACCCCGCTCACCCTGGCCGAG
CATCTGCGCGCCGCCCGCGCCTGA
[8] C17..298
[8] A497..552
[8] PCP636..703
[8] C49..894
[8] A1489..1656
[8] PCP1906..2109

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [496-552]  1.8e-07 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [17-298]  9.60000000000003e-42 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [629-704]  1.89999859865864e-15 SSF47336
SSF47336   ACP_like
 [632-705]  1.8e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [639-702]  4.1e-11 PF00550
PF00550   PP-binding
 [636-703]  PS50075
PS50075   ACP_DOMAIN
SignalP
 [1-31]  0.151 Signal
Eukaryota   
TMHMM No significant hit