close all open/close all

CDS information : Strply_00050


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction7,337 / 6,495 / - [in whole cluster]
7,337 / 6,495 / - [in contig]
Locationcomplement(6495..7337) [in whole cluster]
complement(6495..7337) [in contig]
TypeCDS
Length843 bp (280 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)slgL
EC number
Keyword
  • tetramic acid moiety
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[22569159] Novel compounds produced by Streptomyces lydicus NRRL 2433 engineered mutants altered in the biosynthesis of streptolydigin. (J Antibiot (Tokyo). , 2012)
[25621700] Discovery of a new family of Dieckmann cyclases essential to tetramic acid and pyridone-based natural products biosynthesis. (Org Lett. , 2015)
Related Reference
ACC
F1DI35
PmId
[25621700] Discovery of a new family of Dieckmann cyclases essential to tetramic acid and pyridone-based natural products biosynthesis. (Org Lett. , 2015)

close this sectionSequence

selected fasta
>cyclase [hypothetical protein]
MNTSLNASDAPRAAAPAAPDGWKVLHDGGPGELVLAVDYASTGRRESSFFDIVPNLPADR
TVWETTQPALGQETEMGGAAYVARWMRAVTESGRYVRAVMGYCVGSVFAAALAEEIGRIQ
AEPPAVLMFDPSVPVSVNLRHDFCNVIDHYATILTEDEVVHCKAEAHRLFAEDDDFDRLG
ARYSRMFEEVVETAFVRSELDVELGRELSDTFVSFVRYLVAARQVDPSRVWARGTAVSSR
DSTPAADLAGREIQFDIDHLDILRDPGVGRAVTELLTAPR
selected fasta
>cyclase [hypothetical protein]
GTGAATACATCCCTGAACGCGTCGGACGCACCCCGTGCGGCGGCCCCCGCCGCCCCGGAC
GGCTGGAAGGTGCTCCACGACGGCGGCCCCGGCGAACTGGTGCTGGCCGTCGACTACGCC
TCCACCGGCCGGCGCGAGTCCAGCTTCTTCGACATCGTCCCCAACCTGCCCGCGGACCGG
ACCGTCTGGGAGACCACCCAGCCCGCGCTCGGGCAGGAGACCGAGATGGGCGGCGCCGCG
TACGTGGCCCGCTGGATGCGCGCGGTCACGGAGTCCGGCCGGTACGTCCGGGCCGTCATG
GGCTACTGCGTGGGCAGCGTCTTCGCGGCCGCGCTGGCCGAGGAGATCGGCCGGATCCAG
GCCGAGCCGCCCGCGGTGCTGATGTTCGACCCCTCCGTGCCGGTCTCGGTCAACCTCCGG
CATGACTTCTGCAACGTCATCGACCACTACGCGACCATCCTCACCGAGGACGAGGTCGTC
CACTGCAAGGCCGAGGCGCACCGGCTGTTCGCCGAGGACGACGACTTCGACCGGCTGGGG
GCGCGGTACTCCCGGATGTTCGAGGAGGTCGTGGAGACCGCCTTCGTCCGCAGCGAACTG
GACGTCGAGCTGGGCCGCGAACTGTCGGACACCTTCGTCTCCTTCGTCCGCTACCTGGTC
GCCGCCCGGCAGGTGGACCCCAGCCGCGTCTGGGCGCGGGGCACCGCCGTCAGCTCACGG
GACTCGACCCCGGCCGCCGACCTCGCCGGCCGCGAGATCCAGTTCGACATCGACCACCTC
GACATCCTCCGCGACCCCGGCGTCGGCCGGGCGGTGACCGAGCTGCTGACCGCTCCCCGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-7]  0.447 Signal
Bacteria, Gram-negative   
TMHMM No significant hit