close all open/close all

CDS information : Strply_00060


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction8,672 / 7,392 / - [in whole cluster]
8,672 / 7,392 / - [in contig]
Locationcomplement(7392..8672) [in whole cluster]
complement(7392..8672) [in contig]
TypeCDS
Length1,281 bp (426 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative methyltransferase
Product (GenBank)methyltransferase
Gene
Gene (GenBank)slgM
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[21398531] Biosynthesis of the RNA polymerase inhibitor streptolydigin in Streptomyces lydicus: tailoring modification of 3-methyl-aspartate. (J Bacteriol. , 2011)

close this sectionSequence

selected fasta
>putative methyltransferase [methyltransferase]
MSEQRVPTHQPPSAPEPARGDHEGQTLNSFYGAFPYPWSPHQLTTLDDPAFYTRFLCQDV
GDDTGGRVPVDADIWVAGCGTNQALITALRFPGARVLGTDASENSLALCEANARSLGVSN
LTLRHEGLTKAAYREQFDYVLCTGVIHHNPDPSVCLRSLAAALRPDAVLELMVYNTYHRQ
EMIAFQKALTLIGIDQVGELPERLALARGLGESVPADGLLGRKMEMFEYTDEAAWADSWM
SPLEHSYSVEELAAMADGCGLALETPTVNAFDQVSDSNQWDVPVPDGELRARYDALPDPT
RWQLVNLLLMDRSPMLWFYLGRAGRPRRTEAERDRAFLDTVHRHSAARQRRWTRQPDGGY
QEAAATTAFPAAKPPAAVRPLYDAVDGERTIRQLLADLGATPTPAEVRSARLQLTSSQFP
FLVAAR
selected fasta
>putative methyltransferase [methyltransferase]
GTGTCCGAGCAGCGCGTACCGACGCACCAGCCCCCCAGCGCCCCCGAACCGGCGCGCGGG
GACCACGAGGGCCAGACCCTCAACTCCTTCTACGGTGCCTTCCCCTACCCCTGGTCGCCG
CACCAGCTGACCACGCTGGACGACCCGGCCTTCTACACCCGCTTCCTGTGCCAGGACGTG
GGCGACGACACGGGCGGCCGGGTCCCCGTCGACGCCGACATCTGGGTCGCCGGCTGCGGC
ACGAACCAGGCGCTGATCACCGCCCTGCGCTTCCCGGGCGCCCGCGTCCTGGGCACCGAC
GCCTCCGAGAACTCCCTCGCGCTGTGCGAGGCCAACGCCCGCAGCCTCGGCGTCAGCAAC
CTGACGCTCCGTCACGAGGGGCTGACGAAGGCCGCGTACCGCGAGCAGTTCGACTACGTC
CTGTGCACCGGCGTCATCCACCACAACCCGGACCCGTCGGTCTGTCTGCGGTCGCTGGCC
GCCGCCCTGCGGCCGGACGCCGTGCTGGAGCTGATGGTCTACAACACCTACCACCGCCAG
GAGATGATCGCCTTCCAGAAGGCGCTCACCCTGATCGGCATCGACCAGGTGGGGGAGCTG
CCCGAGCGGCTCGCGCTGGCCCGCGGGCTGGGGGAGTCCGTACCGGCCGACGGGCTGCTC
GGCCGCAAGATGGAGATGTTCGAGTACACCGACGAGGCGGCCTGGGCCGACAGTTGGATG
AGTCCCCTCGAACACAGCTACTCCGTCGAGGAGCTGGCGGCGATGGCGGACGGCTGCGGC
CTCGCCCTGGAGACGCCCACCGTCAACGCCTTCGACCAGGTCAGCGACAGCAACCAGTGG
GACGTCCCGGTGCCGGACGGCGAGCTGCGCGCCCGCTATGACGCGCTGCCGGACCCGACG
CGCTGGCAGCTGGTCAACCTGCTGCTGATGGACCGCTCGCCGATGCTGTGGTTCTACCTG
GGCCGGGCCGGCCGGCCGCGCCGCACCGAGGCCGAGCGCGACCGCGCGTTCCTGGACACC
GTGCACCGCCACAGCGCCGCCCGCCAGCGCCGCTGGACCCGGCAGCCGGACGGCGGCTAC
CAGGAGGCGGCGGCCACCACGGCCTTCCCCGCGGCCAAGCCGCCCGCCGCGGTCCGCCCC
CTGTACGACGCCGTCGACGGCGAGCGCACGATCCGGCAGCTGCTCGCGGACCTGGGTGCC
ACCCCCACCCCGGCCGAAGTGCGCAGCGCGCGGCTGCAATTGACGAGCAGTCAATTCCCG
TTCCTGGTCGCCGCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit