close all open/close all

CDS information : Strply_00070


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction9,423 / 8,767 / - [in whole cluster]
9,423 / 8,767 / - [in contig]
Locationcomplement(8767..9423) [in whole cluster]
complement(8767..9423) [in contig]
TypeCDS
Length657 bp (218 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)NDP-hexose-3,5-epimerase
Gene
Gene (GenBank)slgS7
EC number5.1.3.-
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
Q9L9E5
PmId
[16514445] Characterisation of Streptomyces spheroides NovW and revision of its functional assignment to a dTDP-6-deoxy-D-xylo-4-hexulose 3-epimerase. (Chem Commun (Camb). , 2006)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [NDP-hexose-3,5-epimerase]
MRYRELSIEGGLLLSPDKITDSRGCFYEAYRPGELADHAGHPFTVAQTNFSVSAHGVLRG
IHGTLTPPGQAKIVTCHRGAVLDVIVDLRQGSPTFGRHQSQVLRAESGAAVYLAEGLGHA
FLALTDDTCVGYLCSTPFVPGTQIDLDPFDPDLAIDWGPAKDLHVSEKDRRAPGLAEAAR
SGLLPRYGDCLALYERLRRAADPSAPPDPGARTAAAPS
selected fasta
>putative NDP-hexose epimerase [NDP-hexose-3,5-epimerase]
ATGCGGTACCGCGAACTGAGCATCGAGGGCGGCCTGCTGCTGTCCCCCGACAAGATCACC
GACTCCCGCGGCTGCTTCTACGAGGCGTACCGGCCCGGTGAACTCGCCGACCACGCGGGC
CACCCCTTCACCGTCGCCCAGACCAACTTCTCCGTCTCGGCACACGGGGTGCTGCGCGGC
ATCCACGGCACGCTCACCCCGCCCGGCCAGGCCAAAATCGTCACCTGCCACCGGGGCGCC
GTACTGGACGTGATCGTCGACCTCCGCCAGGGGTCGCCCACCTTCGGCCGGCACCAGAGC
CAGGTGCTGCGTGCCGAGTCCGGCGCGGCCGTGTACCTCGCCGAGGGCCTGGGACACGCC
TTCCTCGCCCTCACCGACGACACCTGCGTGGGGTACCTGTGCTCCACCCCGTTCGTACCG
GGCACCCAGATCGACCTCGACCCCTTCGACCCGGACCTCGCCATCGACTGGGGACCGGCG
AAGGACCTGCACGTCTCGGAGAAGGACCGGCGGGCGCCCGGGCTCGCCGAGGCGGCGCGG
TCCGGGCTGCTGCCCCGCTACGGCGACTGCCTGGCGCTCTACGAGCGGCTCCGCCGGGCC
GCGGACCCTTCCGCGCCGCCGGACCCGGGCGCCCGGACCGCGGCGGCCCCCTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [4-177]  1.40000000000001e-49 PF00908
PF00908   dTDP_sugar_isom
 [21-182]  PD001462
PD001462   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-182]  6.39998633403535e-63 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-189]  2.59999999999998e-57 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit