close all open/close all

CDS information : Strply_00080


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction10,709 / 9,405 / - [in whole cluster]
10,709 / 9,405 / - [in contig]
Locationcomplement(9405..10709) [in whole cluster]
complement(9405..10709) [in contig]
TypeCDS
Length1,305 bp (434 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase
Product (GenBank)NDP-hexose-3,4-dehydratase
Gene
Gene (GenBank)slgS6
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
Q9ALN8
NITE
Spino_00050
PmId
[17076492] Characterization of SpnQ from the spinosyn biosynthetic pathway of Saccharopolyspora spinosa: mechanistic and evolutionary implications for C-3 deoxygenation in deoxysugar biosynthesis. (J Am Chem Soc. , 2006)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase [NDP-hexose-3,4-dehydratase]
MTDSKARILEQVRGYHQENERRGFTPGVTPIWPSGAVLDEDDRVALVEAALDMRIAAGVS
SRRFERELAKALGLRKAHLTNSGSSANLLALSALTSPQLEDRRLRPGDEVITVAAGFPTT
VNPILQNGMVPVFVDVELGTYNTTPERIAEAIGPRTRAIMVAHALGNPFAAAEVAELAEA
HDLFLVEDNCDALGSTYRGQLTGTFGDLATVSFYPAHHITTGEGGSVLTSNLVLARIVEQ
LRDWGRDCWCEPGEDNTCFKRFDYQMGTLPHGYDHKYIFSHVGYNLKSTDLQAALGLSQL
AKLPAFGEARRRNWQRLRDGLEGVPGLLLPRATEGSDPSWFGFALTVLPDASFKVKELTD
FLESRKIGTRRFFSGNLTRHPAYLDRPHRVVGDLANSDTVTGSTFWIGVFPGLTEEMTDY
VSASIREFVCGTAN
selected fasta
>putative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase [NDP-hexose-3,4-dehydratase]
ATGACCGACAGCAAGGCGCGGATCCTGGAGCAGGTGCGCGGCTACCACCAGGAGAACGAA
CGCCGGGGATTCACACCGGGGGTCACCCCCATCTGGCCGTCGGGCGCCGTACTCGACGAG
GACGACCGGGTCGCGCTGGTCGAGGCGGCGCTGGACATGCGGATCGCGGCCGGGGTCAGC
TCGCGCCGGTTCGAGCGGGAGCTGGCCAAGGCGCTCGGCCTGCGCAAGGCGCACCTGACC
AACTCCGGTTCCTCGGCGAACCTGCTGGCCCTGTCGGCGCTGACCTCACCGCAGCTGGAG
GACCGCCGGCTGCGGCCCGGTGACGAGGTGATCACCGTGGCGGCCGGCTTCCCGACCACC
GTCAACCCCATCCTCCAGAACGGCATGGTCCCGGTCTTCGTCGACGTCGAGCTGGGGACG
TACAACACCACCCCGGAGCGGATCGCCGAGGCGATCGGGCCCCGCACCCGCGCGATCATG
GTTGCGCATGCGCTGGGCAACCCGTTCGCCGCGGCCGAGGTGGCCGAACTCGCCGAGGCG
CACGACCTGTTCCTCGTCGAGGACAACTGCGACGCCCTGGGCTCGACCTACCGCGGGCAG
CTCACCGGGACCTTCGGGGACCTGGCGACCGTCAGCTTCTACCCCGCGCACCACATCACC
ACCGGCGAGGGCGGCAGCGTCCTCACGTCGAACCTCGTGCTCGCCCGGATCGTCGAGCAA
CTGCGGGACTGGGGCCGGGACTGCTGGTGCGAACCGGGCGAGGACAACACCTGCTTCAAG
CGGTTCGACTACCAGATGGGCACGCTGCCGCACGGCTACGACCACAAGTACATCTTCTCC
CACGTCGGGTACAACCTGAAGTCCACCGACCTCCAGGCCGCCCTGGGGCTGAGCCAGCTC
GCCAAGCTCCCCGCGTTCGGCGAGGCCCGCCGCCGCAACTGGCAGCGCCTGCGGGACGGG
TTGGAGGGCGTGCCCGGACTGCTGCTGCCGCGGGCCACCGAGGGCAGCGACCCCAGCTGG
TTCGGCTTCGCCCTCACCGTGCTGCCCGACGCCTCGTTCAAGGTCAAGGAGCTCACCGAC
TTCCTGGAGTCCCGCAAGATCGGCACCCGCCGCTTCTTCAGCGGCAACCTCACCCGCCAC
CCCGCCTACCTCGACCGGCCGCACCGGGTCGTGGGGGACCTGGCCAACTCCGACACGGTG
ACCGGGAGCACCTTCTGGATCGGCGTCTTCCCGGGCCTGACCGAGGAGATGACGGACTAC
GTCAGCGCCTCGATCCGGGAGTTCGTATGCGGTACCGCGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [41-426]  5.50000000000008e-97 PF01041
PF01041   DegT_DnrJ_EryC1
 [4-433]  1.39999277195148e-108 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [29-301]  1.10000000000001e-69 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [302-426]  8.70000000000003e-45 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [25-433]  4.80002938964646e-92 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit